DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and B0218.5

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_501367.1 Gene:B0218.5 / 181853 WormBaseID:WBGene00015049 Length:367 Species:Caenorhabditis elegans


Alignment Length:385 Identity:89/385 - (23%)
Similarity:159/385 - (41%) Gaps:58/385 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHG--NGPLFVEMHFYLRNAKLEDIKQFM 106
            |.::::...:|.||:|.:|:..::.:....| :|||...  ...|:::.:.....||::. :.|.
 Worm    21 KDRYKVLALLGKGGYGAVYSVLRLSDMEKFA-IKCENAAACRKALYMDCNVLKGAAKIQS-RHFC 83

  Fly   107 QKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGK-RLPEGTVYRLAIQMLDV 170
            .           ::...:|:   .:..||||...|.:|........: |..:||..:.|.|.|..
 Worm    84 T-----------VIDQAAVK---NRFNFIVMKLIGKNLWDLRMDTAECRFTKGTSLKAASQCLIS 134

  Fly   171 YQYMHSNGYVHADLKAANILLGLEKGGAAQA-YLVDFGLASHFV---TGDFKPD-PKKMHNGTIE 230
            .:.:|..|::|.|:|..|..:|.::...... :::||||...||   .|..:.. .|....||..
 Worm   135 IEELHRFGFLHRDIKPGNFAVGRKESNEHHTIFMLDFGLCREFVKRGEGRLRTQRAKSQFRGTTR 199

  Fly   231 YTSRDAHLGVPT-RRADLEILGYNLIEWLGAELPW------VTQKLLAVPPKVQKAKEAFMDNIG 288
            |...::.|.:.| |:.|:|...|.:.||....|||      ..:|:|.....|:..||...|   
 Worm   200 YAPINSMLEIDTGRKDDIESWLYMVAEWTSGGLPWRKFKATEREKVLKYKKDVRTDKEIMAD--- 261

  Fly   289 ESLKTLFPKGVPPPIGDF---MKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQ 350
                 ||   ...|:.:|   :|||.:|....||||.........|....||.:...||:     
 Worm   262 -----LF---YNCPLKEFERILKYVDELDFYSEPDYKFVYCCLQHAAAASKIKDTDPLDW----- 313

  Fly   351 TSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKISASED--DEEEEEKSHRKKTAKK 408
               :.|:...|..:.....|..::|   ::..:..::|.::.  |.|..:.:.|.:..||
 Worm   314 ---DPNVPYMGPIETIGDGKVIELD---VDQGMSTEVSFNKTGRDRETADATKRVEIKKK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 74/301 (25%)
SPS1 47..432 CDD:223589 88/382 (23%)
Pol_alpha_B_N <399..>502 CDD:285602 3/10 (30%)
B0218.5NP_501367.1 PKc_like 23..297 CDD:389743 73/300 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.