DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and tag-191

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_506600.1 Gene:tag-191 / 179960 WormBaseID:WBGene00007049 Length:346 Species:Caenorhabditis elegans


Alignment Length:373 Identity:97/373 - (26%)
Similarity:150/373 - (40%) Gaps:80/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MPEKVKEGTVFTDLAKG-QWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHGN----GPLFV 88
            ||:.|.:.|:...:..| ::|:...:|.||.|.:|....:.:|.....:|.|.:.|    ..|.:
 Worm     1 MPDDVCDETLKIGVVVGKKYRVIQQLGQGGCGSVYKVEDIEDKTKQYAMKVEFNSNANAGNVLKM 65

  Fly    89 EM----HFYLRNAKLEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHR--FIVMPRYGSDLTKF 147
            |:    |...:|            |..|.:            .:|:|.|  ::||...|..|...
 Worm    66 EVQILTHLVSKN------------HVAKCM------------ASGKKDRYSYVVMTLLGESLESL 106

  Fly   148 LEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLV--DFGLAS 210
            ::::|......|..|:.|.:|...:.:|..|::|.|||.||:.|| .||...:.|.:  |||||.
 Worm   107 MKKHGPFFNVSTQMRIGICLLFGIKQIHDIGFIHRDLKPANVALG-NKGSPDERYFIVLDFGLAR 170

  Fly   211 HFVTGDFKPDPKKMH--------NGTIEYTSRDAHLGVPTRRA-DLEILGYNLIEWLGAELPWVT 266
            .::|.  |.|.|||.        .||..|.|...|......|. ||..|.|.|.| |..:|.|..
 Worm   171 QYITD--KEDGKKMRRPREKALFRGTSRYCSVAMHDRFEQGRVDDLWALIYMLAE-LRCQLAWSD 232

  Fly   267 QKLLAVPPKVQKAKEAFMDNIGESLK-----TLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRS 326
                 :..||:         |||..:     .||.|. |..:.:|:|.|........|||:|..:
 Worm   233 -----LDDKVE---------IGEMKRHVADQNLFAKS-PIQMLEFVKIVRATQFYHRPDYEKLFN 282

  Fly   327 WFSSALKQLKIPNNGDLDF-----KMKPQTSSNNN-----LSPPGTSK 364
            ..:.|:|..|...:....:     |.||...:..|     ::||...:
 Worm   283 LLNDAMKSAKYKWSDPYHWEPEKRKKKPSVPAVGNVPRKGVTPPSNEE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 85/318 (27%)
SPS1 47..432 CDD:223589 92/354 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
tag-191NP_506600.1 STKc_TTBK 19..285 CDD:270919 83/308 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.