DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and C50F4.10

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_505456.2 Gene:C50F4.10 / 179334 WormBaseID:WBGene00008235 Length:317 Species:Caenorhabditis elegans


Alignment Length:310 Identity:76/310 - (24%)
Similarity:124/310 - (40%) Gaps:62/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TDLAKG----QWRIGPSIGVGGFGEIYAACKVGE--KNY-DAVVKCEPHGNGPL-------FVEM 90
            |:|..|    :|.|...|..|.|..|| .|....  .|| ...:||| ....||       ||..
 Worm     8 TNLFPGTQVYKWTIEKKIAQGDFNFIY-MCNGSSNMSNYKQFALKCE-SAQSPLQMLKVEAFVLQ 70

  Fly    91 HFYLRNAK----LEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQN 151
            ....|.::    :|||.:|...|                        :|||...|..|..:::.:
 Worm    71 TIAKRGSRHFCDIEDIGKFQGIH------------------------YIVMHMIGRALVDYMKTS 111

  Fly   152 -GKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLG-LEKGGAAQAYLVDFGLASHFVT 214
             ...:.......:.||:::..:.:|:.|::|.|||.:||..| .::....:.||:.||::..:: 
 Worm   112 MSGAISVNCALSVGIQLIEALEDLHNCGFIHRDLKPSNICFGRKDRNELGKLYLLSFGISRRYL- 175

  Fly   215 GDFKPDPKKMHN-----GTIEYTSRDAH-LGVPTRRADLEILGYNLIEWLGAELPWVTQKLLAVP 273
             |.|...:|..:     ||:.|.|.:.| |....|:.|||...|.::|.:..:|||   |.|...
 Worm   176 -DSKNQMRKPRDNVEFRGTVRYASLNCHQLQELNRKDDLESAFYVIVEMITGQLPW---KGLPDG 236

  Fly   274 PKVQKAKEAFMDNIGESLKTLFPKGVPP--PIGDFMKYVSKLTHNQEPDY 321
            ..|.:.|:   .:...|...||.:...|  .:.:.|..:....:...|||
 Worm   237 AAVARVKQ---QSRHPSAIALFLRAPCPMEELREVMILIDSYNYFTAPDY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 76/310 (25%)
SPS1 47..432 CDD:223589 73/299 (24%)
Pol_alpha_B_N <399..>502 CDD:285602
C50F4.10NP_505456.2 PKc_like 18..291 CDD:389743 73/300 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.