DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and K11C4.1

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_504751.1 Gene:K11C4.1 / 179078 WormBaseID:WBGene00019642 Length:308 Species:Caenorhabditis elegans


Alignment Length:343 Identity:84/343 - (24%)
Similarity:142/343 - (41%) Gaps:73/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHGNGPLFVEMHFYLR 95
            ::|...|||..|           |.|.||.:||.  ..:...:..:|.|........:::..|: 
 Worm    14 DRVNRFTVFKKL-----------GEGTFGAVYAV--RDDAGAEHALKAELATEKIPLLKLELYV- 64

  Fly    96 NAKLEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKR------ 154
                      |||..:|.   |..:|....:...|...:|||...|..|     |:.|:      
 Worm    65 ----------MQKLSMKG---PKHMATLIDKGRHENFNYIVMKFLGKSL-----QDAKKTGPDGH 111

  Fly   155 LPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLG-LEKGGAAQAYLVDFGLASHFVTGD-- 216
            |..|:....:||.|:..:.:|..|::|.|:|..|..|| .|.|...:.:::||||...||...  
 Worm   112 LTLGSAIGASIQCLEALEELHWCGFLHRDVKPGNFCLGRAELGELRKIFVLDFGLCRKFVDDRNV 176

  Fly   217 -FKPDPKKMHNGTIEYT-----SRDAHLGVPTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPK 275
             .:|..|..:.||..|.     :|..|    .|:.|:|...|.|:::..|.|||   |::...|:
 Worm   177 MLQPRRKAPYRGTPRYAPIASHNRAEH----GRKDDVESWFYMLVDFTNAALPW---KVVNEIPQ 234

  Fly   276 VQKAKEAFMDNIGESLKTLFPKGVPPPIGDF---MKYVSKLTHNQEPDYDKCRSWFSSALKQL-- 335
            |.:.|:   ::..:.|.|....|.  |:.::   |.::..|:...||:|    ....|.||:|  
 Worm   235 VGEMKK---NSRFDPLVTQLLAGC--PVDEYRLIMNHIDGLSFFMEPNY----GLIYSTLKRLMQ 290

  Fly   336 -----KIPNNGDLDFKMK 348
                 :.|.:.:.::.:|
 Worm   291 TRNIQEFPYDWEAEYAVK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 77/309 (25%)
SPS1 47..432 CDD:223589 79/327 (24%)
Pol_alpha_B_N <399..>502 CDD:285602
K11C4.1NP_504751.1 PKc_like 18..286 CDD:389743 78/315 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.