DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and ZK596.2

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_502028.1 Gene:ZK596.2 / 177983 WormBaseID:WBGene00014007 Length:305 Species:Caenorhabditis elegans


Alignment Length:312 Identity:72/312 - (23%)
Similarity:124/312 - (39%) Gaps:52/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHGN--GPLFVEMHFYLRNAKLEDIKQFMQ 107
            |:|.|...:|.|.||.:|...:..:...:..:|.|...:  |.|.:|:...|...|    ::.:.
 Worm    17 GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKK----QKIVG 77

  Fly   108 KHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYG---SDLTKFLEQNGKRLPEGTVYRLAIQMLD 169
            :|.|:      :...|::.   :|..::||...|   .||.|....|  :...||...:|.|.|:
 Worm    78 RHFLE------LADRGNLP---QKFNYMVMTLVGKSLQDLRKTAPFN--KFSMGTAISVARQSLE 131

  Fly   170 VYQYMHSNGYVHADLKAANILLG-LEKGGAAQAYLVDFGLASHFVTGD---FKPDPKKMHNGTIE 230
            ..:.:|:.|::|.|:|..|..:| .|.....:.|::|||:|..|...|   ..|..:....||::
 Worm   132 AVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196

  Fly   231 YTSRDAHL-GVPTRRADLEILGYNLIEWLGAELPW--VTQKLLAVPPKVQKAKEAFMDNIG---- 288
            |.....|: ....|:.|:|...|.::|.....|||  :|:.                |::|    
 Worm   197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTES----------------DDVGVFKK 245

  Fly   289 ----ESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLK 336
                ..|:.|| .|.|....:....:.|......|:|.........|:...|
 Worm   246 ECKTTRLRCLF-GGCPREFTEVFPILDKGKFFDAPEYTTIYELLEKAMVNTK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 70/302 (23%)
SPS1 47..432 CDD:223589 71/310 (23%)
Pol_alpha_B_N <399..>502 CDD:285602
ZK596.2NP_502028.1 STKc_TTBK 18..289 CDD:270919 69/302 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.