DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and F36H12.9

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_500758.1 Gene:F36H12.9 / 177303 WormBaseID:WBGene00018123 Length:380 Species:Caenorhabditis elegans


Alignment Length:417 Identity:104/417 - (24%)
Similarity:167/417 - (40%) Gaps:83/417 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KEGTVFTDLAKGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAK 98
            ||..:| ...|.::::...:|.||:|.:|:..::.:....| :|||....|          :...
 Worm    12 KEDEMF-KTKKDKYKVIALLGKGGYGAVYSVLRLSDMEKFA-IKCEKATAG----------KKVL 64

  Fly    99 LEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGK-RLPEGTVYR 162
            |.|.........:||.....:|...:|:   ::..||||...|.:|....:..|. :...||..:
 Worm    65 LMDCNVMKGATQIKSRHFCTVLDRANVK---DRFNFIVMKLIGKNLWDLRQDRGDGKFTMGTSLK 126

  Fly   163 LAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQA-YLVDFGLASHFV------------- 213
            .|.|.|...:::||.||:|.|:|..|...|.::...... :::||||...:|             
 Worm   127 AASQCLVSIEHLHSFGYLHRDIKPGNFAAGRKESNEHHVIFMLDFGLCREYVKRAEGKDLRAART 191

  Fly   214 TGDFKPDPKKMHNGTIEYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVP-PKV 276
            |..|:        ||..|....:.|.. .:|:.|:|...|.::||....|||  :||.|.. .||
 Worm   192 TAPFR--------GTTRYAPLASMLQQDQSRKDDIESWLYMVVEWTSGGLPW--RKLKAHDREKV 246

  Fly   277 QKAKEAFMDNIGESLKTLFPKGVPPPIGDF------------MKYVSKLTHNQEPDYDKCRSWFS 329
            .:.|        :.|:|     .|..:.||            :||:..|.:...|||........
 Worm   247 LQYK--------QDLRT-----KPDILDDFLFLCPKKEFTRILKYLDTLGYYAVPDYKFIYFCVQ 298

  Fly   330 SALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLN--SSLD-EKISASE 391
            .|....||.:...||:  .|:|.....:..||..|.        ||..|..  |:.| .|.:|.|
 Worm   299 HAANANKIKDADPLDW--DPETPYMGPIEQPGDGKV--------IDLEVEGGASTKDFSKRNAKE 353

  Fly   392 DDEEEEEKSHRKKTA---KKVTPSARN 415
            .|:.:|.:..:|||:   .|...|::|
 Worm   354 KDQSDETRKGKKKTSGSPNKERTSSKN 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 76/320 (24%)
SPS1 47..432 CDD:223589 100/404 (25%)
Pol_alpha_B_N <399..>502 CDD:285602 6/20 (30%)
F36H12.9NP_500758.1 PKc_like 23..296 CDD:389743 74/309 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.