DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and R13H9.5

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_500715.1 Gene:R13H9.5 / 177276 WormBaseID:WBGene00020071 Length:311 Species:Caenorhabditis elegans


Alignment Length:326 Identity:75/326 - (23%)
Similarity:122/326 - (37%) Gaps:95/326 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHG 110
            :|.|...:|.||.|.:|...       ||..|..                 .|:|.|.:.||...
 Worm    19 RWSITKKLGEGGCGAVYLCT-------DATGKYA-----------------LKVEGISEAMQVLK 59

  Fly   111 LKSLGMPYILANGSVEVNGEKH-------------RFIVMPRYGSDLTKFLEQNGKRLPEGTVYR 162
            ::      :|..|.:...|.:|             .::||...|..|        :.|.:||..:
 Worm    60 ME------VLVLGELTKRGSRHFCKIEDKGRYGSFNYVVMTLVGKSL--------QDLRKGTAQQ 110

  Fly   163 ---------LAIQMLDVYQYMHSNGYVHADLKAANILLG-LEKGGAAQAYLVDFGLASHFVTGD- 216
                     :.||.|:..:.:|:.||:|.|:|..|..:| .|.....:.|::|||:|..|...: 
 Worm   111 CLSLACSLSVGIQSLEALEDLHNIGYLHRDVKPGNYTIGRAELNELRKVYILDFGMARKFTDNNG 175

  Fly   217 --FKPDPKKMHNGTIEYTSRDAH----LGVPTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPK 275
              .||.......||:.|.....|    ||   |:.|:|:..|..:|.....:||           
 Worm   176 VIRKPRAAAGFRGTVRYAPIACHKNQELG---RKDDVEVWLYMQVELTVGRVPW----------- 226

  Fly   276 VQKAKE-AFMDNIGESLKTL--FPKGV---PPP---IGDFMKYVSKLTHNQEPDYDKCRSWFSSA 331
                || ..|:.:|::.:|:  .|:.:   |.|   :.:.||.|....:..:|:|..|......|
 Worm   227 ----KEITDMNAVGQAKQTIRNTPEKMFVFPCPANELKEIMKMVDSWDYFADPNYADCYRLMKQA 287

  Fly   332 L 332
            |
 Worm   288 L 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 73/320 (23%)
SPS1 47..432 CDD:223589 75/325 (23%)
Pol_alpha_B_N <399..>502 CDD:285602
R13H9.5NP_500715.1 STKc_TTBK 19..285 CDD:270919 73/321 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.