DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and F26A1.3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_497999.1 Gene:F26A1.3 / 175639 WormBaseID:WBGene00017802 Length:512 Species:Caenorhabditis elegans


Alignment Length:385 Identity:88/385 - (22%)
Similarity:146/385 - (37%) Gaps:80/385 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GGFGEIY---AACKVGEKNYDAVVKCEPHGNGPLFVEMHFYLR-------NAKLE---------- 100
            |.||.|:   ..|...::..:...|.:.:.......|:...|:       ||::|          
 Worm   167 GRFGNIHTINVRCMPDDETNEDEEKDKDNSKSKKTKEVQQILKVGRRMNANARIEHEIAILRCFY 231

  Fly   101 DIKQFMQKHGLKS-LGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLA 164
            .::| .:|.|.|. ..:..|:|||  :..|..  :..||....:|.:..:|.|.:......:.:.
 Worm   232 PVEQ-KRKEGEKGPTHITPIIANG--DAGGSP--YFTMPVMDVNLERLKQQIGHKFRWVDSFYIG 291

  Fly   165 IQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGDFK----PDPKKMH 225
            .:.:...:..|....:|.|:|..|:||..|..  ...:|.|||.:...  |:.|    ||..   
 Worm   292 QESMIGIKECHDRSIIHRDIKPTNLLLCREPN--MFWWLCDFGDSCRI--GEVKIISPPDAL--- 349

  Fly   226 NGTIEYTSRDAHLGV-----PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMD 285
              |:.|.||.||...     .|...|:|...|.|:: |...|||  :.::...|.: .||.||..
 Worm   350 --TLPYLSRAAHEATQKPMKATIAMDIESWFYMLLD-LFVVLPW--KNMVEEAPTL-AAKTAFWA 408

  Fly   286 NIGESLKTLFPKGVPP---PIGDFM-------KYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNN 340
            |:.|..:....| :||   ||...:       .|:...|..:: .:||               ||
 Worm   409 NLTEFFQKRAAK-LPPQLLPIAQIVGNSSIEKPYIQLKTILRD-GFDK---------------NN 456

  Fly   341 GDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKISASEDDEEEEEKS 400
            ....:  ||...:..  :||..| |..||..:|...|..|.|..:...|...::::..|:
 Worm   457 AKQPW--KPDWITKR--TPPKAS-AEMARSKEKGSIPKSNESASQTSDAKSKNQKKSPKN 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 72/311 (23%)
SPS1 47..432 CDD:223589 88/385 (23%)
Pol_alpha_B_N <399..>502 CDD:285602 1/2 (50%)
F26A1.3NP_497999.1 PKc_like 208..432 CDD:389743 61/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.