DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and Y39G8C.2

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_496946.1 Gene:Y39G8C.2 / 175061 WormBaseID:WBGene00012731 Length:276 Species:Caenorhabditis elegans


Alignment Length:251 Identity:65/251 - (25%)
Similarity:105/251 - (41%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQK 108
            |..:.:...:|.||||.:|.. |..:.|....:|.|.              :..|.:..|..|:.
 Worm    21 KANYVVSRLLGEGGFGAVYLV-KDTKTNKTFAMKVEQ--------------KMEKRKHSKLKMEI 70

  Fly   109 HGLKSLG----MPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRL-PEGTVYRLAIQML 168
            ..||.:|    ...|:..|..:..|  :.|:||...|..|.....:..:|: ..||...:|.|.|
 Worm    71 AILKLVGAGKHFTQIVDRGKKDKEG--YFFLVMELVGKSLGDLKNERAERVFSFGTGLGVASQCL 133

  Fly   169 DVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFV-TGDFKPDPKKM--HNGTIE 230
            :..:.:|..|::|.|||..|...||:: .....|::|||:|..:: |.:....|::.  ..||:.
 Worm   134 EAVEDLHRTGFIHRDLKPQNYACGLDE-KRHNIYILDFGIARKYLNTKNELKTPREAVGFKGTVR 197

  Fly   231 YTSRDAH----LGVPTRRADLEILGYNLIEW-LGAELPWVTQKLLAVPPKVQKAKE 281
            :.....|    ||   .|.|.|...|.|::. |...|||   :.:....:|.|.||
 Worm   198 FAPLACHRFTELG---PRDDCESWFYLLLDLILPRGLPW---RKMNEKGEVLKEKE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 65/251 (26%)
SPS1 47..432 CDD:223589 64/248 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
Y39G8C.2NP_496946.1 PKc_like 23..276 CDD:389743 64/249 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.