DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and F59A6.4

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_494922.2 Gene:F59A6.4 / 173865 WormBaseID:WBGene00019086 Length:762 Species:Caenorhabditis elegans


Alignment Length:440 Identity:105/440 - (23%)
Similarity:173/440 - (39%) Gaps:138/440 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRVAKPKAAAPAKKVVSAKKAKSKLYKMPEKVKEGTVFTDL-AKGQWRIGPSIGVGGFGEIY-- 62
            :|:..|||  .|.:|                |:.:|.|...: |...|::...:|.||||::|  
 Worm   415 VPKGKKPK--RPTRK----------------KLAKGDVILGVGATDGWKVINLLGSGGFGDVYKV 461

  Fly    63 -------AAC-------KVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNA------KLEDIKQFMQ 107
                   ..|       :.|||.|..           |.:|:...::.|      |.::..:|:.
 Worm   462 HRESQPITKCYALKTESEEGEKRYLR-----------LKIEVTVMMKTAEKKKENKFKNFIEFVD 515

  Fly   108 KHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDL----TKFLEQNGKRLPEGTVYRLAIQML 168
            :...:.|                |.:::||...|..|    .|:|..:   ..:.|.:.:|||.:
 Worm   516 RGKCEQL----------------KCKYVVMGLVGPSLEDIRRKYLLGS---FSKHTSFNVAIQTV 561

  Fly   169 DVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFV--TGDFKPDPKKM-HNGTIE 230
            ...|.:||.||:|.|:|.||..:||| ......|::|||:|..:|  .|:.|...||: ..||:.
 Worm   562 TALQDLHSIGYLHRDIKPANYAVGLE-DREDTVYMLDFGIAKLYVDENGEHKVKRKKVKFLGTLR 625

  Fly   231 YTSRDAHLGVPT-RRADLEILGYNLIEWLGAE--LPWVTQKLLAVPPKVQKAKEAFMDN-----I 287
            |..|...:.... |:.|||...|.:.:.:...  :||   :.|..|.::.|:|..|..|     :
 Worm   626 YACRACMMQQEQGRKDDLETWIYLVFDLMDESHGMPW---RSLCSPKEILKSKNEFFTNFDSSSV 687

  Fly   288 GESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTS 352
            ..:||.|  ||:       :.||..:.:...||||    :..:.||.                  
 Worm   688 SATLKRL--KGL-------VSYVDNMQYETTPDYD----YIINFLKT------------------ 721

  Fly   353 SNNNLSPPGTSKAATARKAKKID--SPVLNSSLD------EKISASEDDE 394
                     |:..|.|:.:||:|  ..:.|...|      :|.::.||||
 Worm   722 ---------TATEAGAKISKKLDWIGKLKNKEFDSESDRSDKKASGEDDE 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 83/329 (25%)
SPS1 47..432 CDD:223589 95/393 (24%)
Pol_alpha_B_N <399..>502 CDD:285602
F59A6.4NP_494922.2 PKc_like 120..372 CDD:304357
SPS1 121..>274 CDD:223589
SPS1 443..>627 CDD:223589 54/214 (25%)
PKc_like 444..720 CDD:304357 80/322 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.