DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and T05A7.6

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_494824.1 Gene:T05A7.6 / 173804 WormBaseID:WBGene00020223 Length:758 Species:Caenorhabditis elegans


Alignment Length:435 Identity:107/435 - (24%)
Similarity:168/435 - (38%) Gaps:128/435 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRVAKPKAAAPAKKVVSAKKAKSKLYKMPEKVKEGTVFTDL-AKGQWRIGPSIGVGGFGEIYAA 64
            :||..|||  .||:|                |:..|.|...: |...|::...:|.||||::|..
 Worm   411 LPRGEKPK--KPARK----------------KLSSGDVILGVGATDGWKVVNLLGSGGFGDVYKV 457

  Fly    65 ---------C-------KVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNA------KLEDIKQFMQ 107
                     |       :.|||.|..           |.||:...::.|      |.::..:|:.
 Worm   458 HRESQASNKCYALKTESEEGEKRYLR-----------LKVEVTVMMKTAEKKKDNKFKNFIEFVD 511

  Fly   108 KHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDL----TKFLEQNGKRLPEGTVYRLAIQML 168
            :...:.|                |.:|:||...|..|    .|:|..:   ..:.|.:.:|||.:
 Worm   512 RGKCEQL----------------KCKFVVMGLVGPSLEDIRRKYLLAS---FSKHTSFNVAIQTV 557

  Fly   169 DVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFV--TGDFKPDPKKM-HNGTIE 230
            ...:.:||.||:|.|:|.||..:||:: .....|::|||:|..:|  .|..|...||: ..||:.
 Worm   558 TALRDLHSLGYLHRDIKPANYAVGLDE-REDTVYMLDFGIAKLYVDENGVHKIKRKKVKFLGTLR 621

  Fly   231 YTSRDAHLGVPT-RRADLEILGYNLIEWLGAE--LPWVTQKLLAVPPKVQKAKEAF--------M 284
            |..|...:.... |:.|||...|.:.:.:...  :||   :.|..|.::.|:|..|        .
 Worm   622 YACRACMMQQEQGRKDDLETWIYLVFDLMDEAHGMPW---RALCDPREILKSKNTFFATFDNFQF 683

  Fly   285 DNIGESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKP 349
            .||.:.||            |.:.||..:.::..|||       |..|..||...| |:..|:..
 Worm   684 SNILKRLK------------DLVVYVDDMQYDTTPDY-------SYILNFLKTTAN-DVGAKITK 728

  Fly   350 QTSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKISASEDDE 394
            :......|            |.|:.||   .|...||....:|:|
 Worm   729 KLDWMGKL------------KQKEFDS---ESEKSEKKGTGDDEE 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 81/332 (24%)
SPS1 47..432 CDD:223589 95/388 (24%)
Pol_alpha_B_N <399..>502 CDD:285602
T05A7.6NP_494824.1 SPS1 100..>321 CDD:223589
PKc_like 116..368 CDD:304357
SPS1 439..>623 CDD:223589 54/214 (25%)
PKc_like 440..716 CDD:304357 80/328 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.