DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and C09D4.3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_491610.1 Gene:C09D4.3 / 172202 WormBaseID:WBGene00015634 Length:406 Species:Caenorhabditis elegans


Alignment Length:365 Identity:80/365 - (21%)
Similarity:151/365 - (41%) Gaps:61/365 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KPKAAAPAKKVVSAKKAKSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAACKVGEK 70
            :|:...||.|....:|.     ::|   ..|..|.:....::.:...:|.|..|.::.:...|. 
 Worm    55 EPRHRGPAIKDKPERKD-----RLP---TVGEYFENDKGDRFILRQKLGDGAMGHVFLSIFGGR- 110

  Fly    71 NYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSLGMPY--ILANGSVEVNGEKHR 133
              ...:|.|.:..|.|.:|:...|.          :::|.    |:.:  |:..|::.   .::.
 Worm   111 --SVAIKAEKYSTGMLPMEIKVLLS----------IRRHN----GVHFCDIIDYGTIR---REYN 156

  Fly   134 FIVMPRYGSDLTKF-LEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGG 197
            ::::...|.||.:. .||..:.....|..::|::.::..:.:|:.||:..|:|.:|...|....|
 Worm   157 YMIISILGKDLYRLRAEQPTRSFTLNTTTKIALETIEAIEELHNIGYLSRDVKPSNFAPGQRDNG 221

  Fly   198 AAQA-YLVDFGLASHFVTGDFKPDPKKMHN-------GTIEYTSRDAH----LGVPTRRADLEIL 250
            ..:. ::.|||||..|:    ..|.||:.:       ||:.|.|..||    ||   ||.|:|..
 Worm   222 QHKTIFMFDFGLAKKFI----DRDNKKLKSRGEVGWRGTVRYGSLQAHKRMDLG---RRDDVECW 279

  Fly   251 GYNLIEWLGAELPW--VTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYVSKL 313
            .|.|||.|..||||  ::.:.|....|:....|:         :.||....|......|..:...
 Worm   280 FYMLIEMLVGELPWRHMSDRTLVGQSKLSIRNES---------RRLFFNRTPRQFETIMDMIDGY 335

  Fly   314 THNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTSS 353
            :....|:|...::..:....:..||:....|::::....|
 Worm   336 SFEIRPEYRHLKALINEIRMENMIPDRCKWDWQVEESQHS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 70/308 (23%)
SPS1 47..432 CDD:223589 72/324 (22%)
Pol_alpha_B_N <399..>502 CDD:285602
C09D4.3NP_491610.1 PKc_like 87..343 CDD:389743 67/291 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.