DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and CSNK1G3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_016864546.1 Gene:CSNK1G3 / 1456 HGNCID:2456 Length:481 Species:Homo sapiens


Alignment Length:399 Identity:92/399 - (23%)
Similarity:156/399 - (39%) Gaps:96/399 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WRIGPSIGVGGFGEI---------------------YAACKVGEKNYD---AVVKCEP-HGNGP- 85
            :|:|..||.|.|||:                     :..|..|:..|.   ..:|.|| ....| 
Human    43 FRVGKKIGCGNFGELRLDQREKPEGCQGTSASLICDFRLCAQGKNLYTNEYVAIKLEPMKSRAPQ 107

  Fly    86 LFVEMHFYLRNAKLEDIKQFMQKHGLKSL----GMPYILANGSVEVNGEKHRFIVMPRYGSDLTK 146
            |.:|..||                  |.|    |:|.:...|..    .|:..:|:...|..|..
Human   108 LHLEYRFY------------------KQLGSGDGIPQVYYFGPC----GKYNAMVLELLGPSLED 150

  Fly   147 FLEQNGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQ--AYLVDFGLA 209
            ..:...:.....||..:|||::...:|:||...::.|:|..|.|:| ..|...|  .:::|||||
Human   151 LFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIG-RPGNKTQQVIHIIDFGLA 214

  Fly   210 SHFVTGDFKPD-PKKMH---NGTIEYTSRDAHLG-VPTRRADLEILGYNLIEWLGAELPWVTQKL 269
            ..::..:.|.. |.:.|   .||..|.|.:.||| ..:||.|||.||:..:.:|...|||...|.
Human   215 KEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKA 279

  Fly   270 LAVPPKVQKAKEAFMDNIGESLKT----LFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSS 330
            ..:..:.||        ||::.:.    :..:..|..:..:::||.:|...::||||..|..|:.
Human   280 DTLKERYQK--------IGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTD 336

  Fly   331 ALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKISASEDDEE 395
            ...:.....:.:.|:                        ..|::.:||.....|..:|::.:..:
Human   337 LFDRKGYMFDYEYDW------------------------IGKQLPTPVGAVQQDPALSSNREAHQ 377

  Fly   396 EEEKSHRKK 404
            ..:|..:.|
Human   378 HRDKMQQSK 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 83/321 (26%)
SPS1 47..432 CDD:223589 92/399 (23%)
Pol_alpha_B_N <399..>502 CDD:285602 2/6 (33%)
CSNK1G3XP_016864546.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.