DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and Csnk1d

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_011246964.1 Gene:Csnk1d / 104318 MGIID:1355272 Length:428 Species:Mus musculus


Alignment Length:452 Identity:119/452 - (26%)
Similarity:180/452 - (39%) Gaps:76/452 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QWRIGPSIGVGGFGEIYAACKVGEKNYDAV-VKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKH 109
            ::|:|..||.|.||:||....:......|: ::|....:..|.:|...|          :.||  
Mouse     8 RYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIY----------KMMQ-- 60

  Fly   110 GLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPEGTVYRLAIQMLDVYQYM 174
              ..:|:|.|...|:   .|: :..:||...|..|........::....||..||.||:...:|:
Mouse    61 --GGVGIPTIRWCGA---EGD-YNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYI 119

  Fly   175 HSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHF---VTGDFKP-DPKKMHNGTIEYTSRD 235
            ||..::|.|:|..|.|:||.|.|.. .|::|||||..:   .|....| ...|...||..|.|.:
Mouse   120 HSKNFIHRDVKPDNFLMGLGKKGNL-VYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASIN 183

  Fly   236 AHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDNIGESLKTLFPKGV 299
            .|||: .:||.|||.|||.|:.:....|||...|......|.::..|..|....|.|    .||.
Mouse   184 THLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL----CKGY 244

  Fly   300 PPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKPQTSSNNNLSPPGTSK 364
            |.....::.:...|..:.:|||...|..|.:...:.....:...|:          |:...|.|:
Mouse   245 PSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDW----------NMLKFGASR 299

  Fly   365 AATARKAKKIDSPVLNSSLDEKISASEDDEEEEEKSHRKKTAKKVTPSARNAKVSPLKRVADSSP 429
            ||...:.::.|                   .||...|.:..|.:..||..:.::...:.||..:|
Mouse   300 AADDAERERRD-------------------REERLRHSRNPATRGLPSTASGRLRGTQEVAPPTP 345

  Fly   430 PSQKRVKTEPKSTPRERATPKASPKPRSTPKASPKPQTPTAARLRTPNAKINFSPSISLRGR 491
                       .||... |...||:|.|..:...|    .:.||.. .|.:|.|.| .|.||
Mouse   346 -----------LTPTSH-TANTSPRPVSGMERERK----VSMRLHR-GAPVNVSSS-DLTGR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 85/287 (30%)
SPS1 47..432 CDD:223589 102/390 (26%)
Pol_alpha_B_N <399..>502 CDD:285602 24/93 (26%)
Csnk1dXP_011246964.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 86/296 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.