DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ball and Vrk3

DIOPT Version :9

Sequence 1:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_598706.1 Gene:Vrk3 / 101568 MGIID:2182465 Length:453 Species:Mus musculus


Alignment Length:384 Identity:95/384 - (24%)
Similarity:169/384 - (44%) Gaps:68/384 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVAKPKAAAPAKKVVSAKKAKSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAA--- 64
            |...||.:..:.:.......::::....:.:..||..||.....|.:|........|.:|.|   
Mouse   101 RPLTPKGSPLSNRQSPQTLKRTRVTTSLQALATGTELTDQNGKHWTLGALQIRDDQGILYEAEPT 165

  Fly    65 ---------------CKVGEKNYDAVVKCEPHGNGPLFVEMHFYLRNAKLEDIKQFMQKHGLKSL 114
                           .|:..|            :|.||.|.:|:.|.||...:.::.::..|..|
Mouse   166 SAVPSESRTQKWRFSLKLDSK------------DGRLFNEQNFFQRVAKPLQVNKWKKQFLLPLL 218

  Fly   115 GMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKR-LPEGTVYRLAIQMLDVYQYMHSNG 178
            .:|..:..|   ::.:|:||:|.|..|..|...|:.|.|. :.|..|.::|.::||..:|:|.|.
Mouse   219 AIPTCIGFG---IHQDKYRFLVFPSLGRSLQSALDDNPKHVVSERCVLQVACRLLDALEYLHENE 280

  Fly   179 YVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGD----FKPDPKKMHNGTIEYTSRDAHLG 239
            |||.:|.|.|:.:..|  ..:|..||.:|....:..|.    :|...:..|:|.:|:.|.|.|.|
Mouse   281 YVHGNLTAENVFVNPE--DLSQVTLVGYGFTYRYCPGGKHVAYKEGSRSPHDGDLEFISMDLHKG 343

  Fly   240 V-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQKAKEAFMDN----IG---------ES 290
            . |:||:||:.|||.:::||...|||.  ..|....|:.:.|:.::|:    :|         |:
Mouse   344 CGPSRRSDLQTLGYCMLKWLYGSLPWT--NCLPNTEKITRQKQKYLDSPERLVGLCGRWNKASET 406

  Fly   291 LKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGDLDFKMKP 349
            |:            :::|.|..|.:.::|.|...|:...:.|:.:::.....||.:|.|
Mouse   407 LR------------EYLKVVMALNYEEKPPYATLRNSLEALLQDMRVSPYDPLDLQMVP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 87/328 (27%)
SPS1 47..432 CDD:223589 88/340 (26%)
Pol_alpha_B_N <399..>502 CDD:285602
Vrk3NP_598706.1 zinc_ribbon_2 4..26 CDD:379084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..123 3/21 (14%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:14645249 49..64
PKc_like 134..436 CDD:389743 87/332 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839533
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.