DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS12 and mtf2

DIOPT Version :9

Sequence 1:NP_651507.1 Gene:IntS12 / 43227 FlyBaseID:FBgn0039459 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001038729.1 Gene:mtf2 / 692292 ZFINID:ZDB-GENE-060512-94 Length:605 Species:Danio rerio


Alignment Length:158 Identity:40/158 - (25%)
Similarity:61/158 - (38%) Gaps:44/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LEDEANFSGRAA---TPPQQ---PIN------ADEIINLTNSPDKEPSDSVDTIADSDDGLSAVG 116
            :.|.|:....||   ||.:|   |::      .|.:.:.|....|. .:..|.:|...|||..:|
Zfish     1 MRDSASADNLAAHQNTPNRQHKSPVSLPRFPLKDGLTDTTKLAGKF-EEGQDVLARWSDGLFYLG 64

  Fly   117 IVN---------------------------TGDTGDFGDLNCCVCGEMVFTATNRLIECSKCGAM 154
            .::                           |||:|  |::.|.:|........|.::.|.|||..
Zfish    65 TISKIDKHKHRCFVIFEDQSKSWVLWKDIQTGDSG--GEMLCSICQNESSEPPNEIVICDKCGQG 127

  Fly   155 YHQECHKPPITKEEAADDQEQNWQCDTC 182
            |||.||.|.|  :.:..|.:..|.|..|
Zfish   128 YHQLCHAPVI--DSSVIDSDDKWLCRQC 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS12NP_651507.1 PHD_Int12 130..182 CDD:276976 17/51 (33%)
mtf2NP_001038729.1 TUDOR 44..95 CDD:197660 7/51 (14%)
PHD1_MTF2 103..155 CDD:277053 18/53 (34%)
PHD2_MTF2 202..253 CDD:277055
Mtf2_C 556..601 CDD:290768
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4323
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.