DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS12 and PHF1

DIOPT Version :9

Sequence 1:NP_651507.1 Gene:IntS12 / 43227 FlyBaseID:FBgn0039459 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_077084.2 Gene:PHF1 / 5252 HGNCID:8919 Length:567 Species:Homo sapiens


Alignment Length:149 Identity:38/149 - (25%)
Similarity:52/149 - (34%) Gaps:41/149 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PRMLEDEANFSGRAATPPQQPINADEIINLTNSPDKEPSDSVDTIADSDDGLSAVGIVNTGDTG- 124
            ||:....|:.....|:|..           |:.|.....:..|.:|...|||..:|.:...|:. 
Human     5 PRLSRSGASSLWDPASPAP-----------TSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAR 58

  Fly   125 -----DFGD--------------------LNCCVCGEMVFTATNRLIECSKCGAMYHQECHKPPI 164
                 .|.|                    |.||||........|||:.|.||...|||:||.|  
Human    59 EVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHVP-- 121

  Fly   165 TKEEAADDQE-QNWQCDTC 182
             :..|..:.| .:|.|..|
Human   122 -RAPAPGEGEGTSWVCRQC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS12NP_651507.1 PHD_Int12 130..182 CDD:276976 20/52 (38%)
PHF1NP_077084.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 7/36 (19%)
Tudor_2 34..69 CDD:375553 9/34 (26%)
PHD1_PHF1 89..139 CDD:276975 20/52 (38%)
PHD2_PHF1 188..239 CDD:277057
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..441
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..537
Mtf2_C <539..565 CDD:372898
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4323
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.