DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS12 and Mtf2

DIOPT Version :10

Sequence 1:NP_651507.1 Gene:IntS12 / 43227 FlyBaseID:FBgn0039459 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_038948078.1 Gene:Mtf2 / 360905 RGDID:1304727 Length:604 Species:Rattus norvegicus


Alignment Length:187 Identity:45/187 - (24%)
Similarity:67/187 - (35%) Gaps:59/187 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PTSAAELRLLLDEALKARFGPEKSLTNNMTPRMLEDEANFSGRAATPPQQPINADEIINLTNSPD 95
            |.|..:..|.||..     |...||.:..:|.....:.:.|                :|..:..|
  Rat     3 PPSMMDCTLKLDST-----GAGNSLVHKRSPSRRNQKTSAS----------------LNKLSLQD 46

  Fly    96 ----KEPS----DSVDTIADSDDGLSAVGI---------------------------VNTGDTGD 125
                |:|:    :..|.:|...|||..:|.                           :.||.||.
  Rat    47 GHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFITFEDSSKSWVLWKDIQTGATGS 111

  Fly   126 FGDLNCCVCGEMVFTATNRLIECSKCGAMYHQECHKPPITKEEAADDQEQNWQCDTC 182
             |::.|.:|.|....|.|.::.|.|||..|||.||.|.|  :.:..|.::.|.|..|
  Rat   112 -GEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHI--DSSVIDSDEKWLCRQC 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS12NP_651507.1 PHD_Int12 130..182 CDD:276976 19/51 (37%)
Mtf2XP_038948078.1 Tudor_MTF2 56..109 CDD:410521 8/52 (15%)
PHD1_MTF2 115..167 CDD:277053 20/53 (38%)
PHD2_MTF2 214..265 CDD:277055
Mtf2_C 555..602 CDD:464077
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.