DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS12 and Phf1

DIOPT Version :9

Sequence 1:NP_651507.1 Gene:IntS12 / 43227 FlyBaseID:FBgn0039459 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_017457076.1 Gene:Phf1 / 294287 RGDID:1303205 Length:624 Species:Rattus norvegicus


Alignment Length:154 Identity:39/154 - (25%)
Similarity:55/154 - (35%) Gaps:35/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PRMLEDEANFSGRAATPPQQPINADEIIN-----LTNSPDKEPSDSVDTIADSDDGLSAVGIVNT 120
            |.:||:.......|..|....:.|..:.:     .|:.|.....:..|.:|...|||..:|.:..
  Rat    53 PGLLENSPPQDAMAQLPRLSRLGAPSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKK 117

  Fly   121 GDTG------DFGD--------------------LNCCVCGEMVFTATNRLIECSKCGAMYHQEC 159
            .|:.      .|.|                    |.||||........|||:.|.||...|||:|
  Rat   118 VDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDC 182

  Fly   160 HKPPITKEEAADDQE-QNWQCDTC 182
            |.|   :..|..:.| .:|.|..|
  Rat   183 HVP---RAPAPGEGEGSSWVCRQC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS12NP_651507.1 PHD_Int12 130..182 CDD:276976 20/52 (38%)
Phf1XP_017457076.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4323
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.