DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment IntS12 and MTF2

DIOPT Version :9

Sequence 1:	NP_651507.1	Gene:	IntS12 / 43227	FlyBaseID:	FBgn0039459	Length:	328	Species:	Drosophila melanogaster
Sequence 2:	NP_031384.1	Gene:	MTF2 / 22823	HGNCID:	29535	Length:	593	Species:	Homo sapiens

Alignment Length:	118	Identity:	33/118 - (27%)
Similarity:	48/118 - (40%)	Gaps:	34/118 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    96 KEPS----DSVDTIADSDDGLSAVGI---------------------------VNTGDTGDFGDL 129
            |:|:    :..|.:|...|||..:|.                           :.||.||. |::
Human    40 KKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGS-GEM 103

  Fly   130 NCCVCGEMVFTATNRLIECSKCGAMYHQECHKPPITKEEAADDQEQNWQCDTC 182
            .|.:|.|....|.|.::.|.|||..|||.||.|.|  :.:..|.::.|.|..|
Human   104 VCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHI--DSSVIDSDEKWLCRQC 154

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
IntS12	NP_651507.1	PHD_Int12	130..182	CDD:276976	19/51 (37%)
MTF2	NP_031384.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..35
		Tudor_MTF2	45..98	CDD:410521	8/52 (15%)
		PHD1_MTF2	104..156	CDD:277053	20/53 (38%)
		PHD2_MTF2	203..254	CDD:277055
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	360..411
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	424..486
		Mtf2_C	544..591	CDD:404871
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4323
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900