DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS12 and phf-30

DIOPT Version :9

Sequence 1:NP_651507.1 Gene:IntS12 / 43227 FlyBaseID:FBgn0039459 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_505182.1 Gene:phf-30 / 188776 WormBaseID:WBGene00020716 Length:234 Species:Caenorhabditis elegans


Alignment Length:212 Identity:49/212 - (23%)
Similarity:80/212 - (37%) Gaps:48/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EVDPVLKKAIKLLHSSNPTSAAELRLLLDEALKARFGPEKSLTNN---------------MTPRM 63
            :.:..:...||.:.|.:.::..|.     ..|.|:.....|.|||               :.|.|
 Worm    27 DANAYISTLIKFMKSIDKSTDKEF-----SELVAKTWSLSSSTNNFYTDSFTMDSGNVSKLNPNM 86

  Fly    64 LEDEANFSG--RAATPPQQPINADEII------NLTNSPD--KEPSDSVDTIADSDDGLSAVGIV 118
            |..:...:|  |....|.|.:|....:      :.:::|.  |:....|..|.||        |.
 Worm    87 LNPQKRIAGTQRLMYAPPQILNKSGFVIDKSGASSSSAPGGMKKLKKLVPVIDDS--------IY 143

  Fly   119 NTGDTGDFGDLNCCVCGEMVFTATNRLIECSKCGAMYHQECHKPPITKEEAADDQEQNWQCDTC- 182
            .|.:.      .|.|| ..|..|.|:::.|.:|...||..|..|.::.|||::...: :.|.|| 
 Worm   144 CTSEQ------PCAVC-HGVSLAGNQVLACRRCRDCYHMACSIPTVSIEEASEPSFK-YYCKTCL 200

  Fly   183 -CNKPTSSGRTTSSAAA 198
             ..|...|.|:.|.:.|
 Worm   201 VSKKVIDSNRSRSPSPA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IntS12NP_651507.1 PHD_Int12 130..182 CDD:276976 16/51 (31%)
phf-30NP_505182.1 PHD 150..202 CDD:366208 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4323
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6919
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006596
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107743
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3479
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.