DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lerp and MRL1

DIOPT Version :9

Sequence 1:NP_001262996.1 Gene:Lerp / 43223 FlyBaseID:FBgn0051072 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_015404.1 Gene:MRL1 / 856194 SGDID:S000006283 Length:381 Species:Saccharomyces cerevisiae


Alignment Length:274 Identity:57/274 - (20%)
Similarity:101/274 - (36%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 ANEVCSFYISYRTPLACLSIPEGLQSNS-----CRVGDTKSNGTFDLMPLSD------------- 222
            |||..:.:...||    |:.|:..:|.:     |.|.:..:....||..||.             
Yeast    34 ANEHRASHKQKRT----LANPDKPKSENDEDLFCAVTNPVTGSYIDLSQLSSTPNKLREGQKQIS 94

  Fly   223 -SNYHTSNR---------QGAFFVINVC-KPVLYGENSMCPAGSSVCLFDSKATNPKERFINFGN 276
             :|.|.|::         ....|.:.:| .||...|:......:.....|....|   ..::.|:
Yeast    95 GNNKHESSKTKWSVRGWGYDTNFTLGICSSPVGEAESQQLSNLTGAFYVDQLNEN---NLVSIGD 156

  Fly   277 VQTHPVVEKG----QLLLRHESPTPCAKNSSANYTSVIYFSCDKFIRN-AHPEFAGLGADSCTYQ 336
            ..|.|.:..|    :|.|::|:.:.| .|......:::.|.|||.|:: |...:.| ...:|:|.
Yeast   157 FSTRPALVGGSTAKKLTLKYENGSMC-PNGKDKKATLLNFVCDKEIQSKAQISYIG-NLHNCSYF 219

  Fly   337 FNFATPLAC------NDLKPCTAF--------------------------TSTNELLDLS-SLSS 368
            |...:..||      |::.....|                          .:.:||.|:| ||:.
Yeast   220 FEVRSIHACPTSNKKNEVNVLGIFIGIFAIFFLVEFAGRRWIYAKLNRHLKNDDELHDISPSLNE 284

  Fly   369 KPARTLLKDGKNYT 382
            :|...|::||..::
Yeast   285 QPHWDLIEDGSRWS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LerpNP_001262996.1 CIMR <49..143 CDD:279250
CIMR 157..298 CDD:279250 31/154 (20%)
CIMR 307..435 CDD:279250 24/110 (22%)
CIMR 445..>574 CDD:279250
CIMR 623..>666 CDD:279250
MRL1NP_015404.1 CIMR 188..>229 CDD:395706 11/41 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1957
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.