DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lerp and m6pr

DIOPT Version :9

Sequence 1:NP_001262996.1 Gene:Lerp / 43223 FlyBaseID:FBgn0051072 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_998370.1 Gene:m6pr / 406486 ZFINID:ZDB-GENE-040426-2285 Length:265 Species:Danio rerio


Alignment Length:197 Identity:39/197 - (19%)
Similarity:69/197 - (35%) Gaps:45/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VISLLLLLFCSGESVAADAANQLKFSTTECK-------------LKEPIYGSTFDFSGLHSDLAH 77
            :|:.|.:||         |..|.:|:|:.||             |.||:....|...|...:...
Zfish     7 IITPLFVLF---------AGVQARFNTSNCKLVSDSESQRKALRLLEPLTNQNFTTEGQEKEKYS 62

  Fly    78 VVKSMNIGGDQFEFNICGNLSRTCNGESNVAACLKRQGKEYI-LGRQHELFYNNGN--MFLKYKS 139
            .:           |.:||:    ..|..|.....:.:|.:.| :|...:.....|:  :.|.|:.
Zfish    63 YI-----------FQVCGD----AGGVKNAGLIQQEKGGKTIRIGDYSKTVATAGSDWVLLIYEG 112

  Fly   140 GAKCDNGTADKPNYQLHVMFSCDYTLDAQPMHVTPYANEV---CSFYISYRTPLACLSIPEGLQS 201
            |.|.|:..:.:....: :|.||. :.......|....|:.   |.:.....|...|.::...|.:
Zfish   113 GEKYDSHCSSEERKAM-IMISCS-SSSKSAFSVVMEENQKQKNCYYLFELDTTAVCPAVSSKLSA 175

  Fly   202 NS 203
            .|
Zfish   176 GS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LerpNP_001262996.1 CIMR <49..143 CDD:279250 21/109 (19%)
CIMR 157..298 CDD:279250 10/50 (20%)
CIMR 307..435 CDD:279250
CIMR 445..>574 CDD:279250
CIMR 623..>666 CDD:279250
m6prNP_998370.1 Man-6-P_recep 11..265 CDD:280342 38/193 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1957
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.