Sequence 1: | NP_001262996.1 | Gene: | Lerp / 43223 | FlyBaseID: | FBgn0051072 | Length: | 918 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998370.1 | Gene: | m6pr / 406486 | ZFINID: | ZDB-GENE-040426-2285 | Length: | 265 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 39/197 - (19%) |
---|---|---|---|
Similarity: | 69/197 - (35%) | Gaps: | 45/197 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 VISLLLLLFCSGESVAADAANQLKFSTTECK-------------LKEPIYGSTFDFSGLHSDLAH 77
Fly 78 VVKSMNIGGDQFEFNICGNLSRTCNGESNVAACLKRQGKEYI-LGRQHELFYNNGN--MFLKYKS 139
Fly 140 GAKCDNGTADKPNYQLHVMFSCDYTLDAQPMHVTPYANEV---CSFYISYRTPLACLSIPEGLQS 201
Fly 202 NS 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lerp | NP_001262996.1 | CIMR | <49..143 | CDD:279250 | 21/109 (19%) |
CIMR | 157..298 | CDD:279250 | 10/50 (20%) | ||
CIMR | 307..435 | CDD:279250 | |||
CIMR | 445..>574 | CDD:279250 | |||
CIMR | 623..>666 | CDD:279250 | |||
m6pr | NP_998370.1 | Man-6-P_recep | 11..265 | CDD:280342 | 38/193 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1957 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |