DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lerp and M6pr

DIOPT Version :9

Sequence 1:NP_001262996.1 Gene:Lerp / 43223 FlyBaseID:FBgn0051072 Length:918 Species:Drosophila melanogaster
Sequence 2:NP_034879.2 Gene:M6pr / 17113 MGIID:96904 Length:278 Species:Mus musculus


Alignment Length:182 Identity:48/182 - (26%)
Similarity:74/182 - (40%) Gaps:32/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLLLLFCSG-------ESVAADAANQL-KFSTTECKLKE---PIYGSTFDFSGLHSDLAHVVKSM 82
            |||||....       |..:.|...:. |.|..|..|.|   |::..:|:            .::
Mouse    13 LLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKSFE------------STV 65

  Fly    83 NIGGDQFE--FNICGNLSRTCNGESNVAACLKRQGKEYILGRQHELFYNNGN--MFLKYKSGAKC 143
            ..|.|.:.  |.:|...|...:| :.:....|...||.::||.:|....||:  :.|.||.|.:.
Mouse    66 GQGSDTYSYIFRVCREASNHSSG-AGLVQINKSNDKETVVGRINETHIFNGSNWIMLIYKGGDEY 129

  Fly   144 DNGTADKPNYQLHVMFSCD-YTLDAQPMHVTPYANEV--CSFYISYRTPLAC 192
            || ...|...:..||.||: :||.|....|:....:|  |.:.....:.|||
Mouse   130 DN-HCGKEQRRAVVMISCNRHTLAANFNPVSEERGKVQDCFYLFEMDSSLAC 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LerpNP_001262996.1 CIMR <49..143 CDD:279250 25/100 (25%)
CIMR 157..298 CDD:279250 13/39 (33%)
CIMR 307..435 CDD:279250
CIMR 445..>574 CDD:279250
CIMR 623..>666 CDD:279250
M6prNP_034879.2 Man-6-P_recep 1..278 CDD:280342 48/182 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1957
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.