DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tl and CD180

DIOPT Version :9

Sequence 1:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_005573.2 Gene:CD180 / 4064 HGNCID:6726 Length:661 Species:Homo sapiens


Alignment Length:586 Identity:145/586 - (24%)
Similarity:229/586 - (39%) Gaps:152/586 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MNITRQHLDRL-------------HGLKRFRFTTRRLTHIPANLLTDMRNLSHLEL----RANIE 186
            ||:|...|.|.             |.|.....|...|..:....|...::|.||.|    .:|:|
Human    77 MNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLIFMAETSLNGPKSLKHLFLIQTGISNLE 141

  Fly   187 EMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPK------LKQLNLWSNQLHNLTKHDFEGAT 245
            .:|.|   :||||||:..|||.:..:      |.||      ||.|:..:|.:|.:::.|.....
Human   142 FIPVH---NLENLESLYLGSNHISSI------KFPKDFPARNLKVLDFQNNAIHYISREDMRSLE 197

  Fly   246 SVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSA---NLFRSLPQGLFDHNKHLNEV--RLMNNRV 305
            ..:.:.::.||            .||..|.|.|   .:|:||.   |....:|:.:  .|.|:..
Human   198 QAINLSLNFNG------------NNVKGIELGAFDSTIFQSLN---FGGTPNLSVIFNGLQNSTT 247

  Fly   306 P---LAT--------LPSRLFANQPELQILRLRAE---LQSLPGDLFEHSTQITNISLGDNLLKT 356
            .   |.|        :.|.:.....|:.:..|..:   ...:....|:..||:..:.|....||.
Human   248 QSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHLKG 312

  Fly   357 LPATLLEHQVNLL-SLDLSNNRLTHLPDSLFAHTTNLTDLRLEDN---LLTGISGDIFSNLGNLV 417
            ||:.:  ..:||| .|.||.|....|.....|:..:||.|.:..|   |..|:.  ....||||.
Human   313 LPSGM--KGLNLLKKLVLSVNHFDQLCQISAANFPSLTHLYIRGNVKKLHLGVG--CLEKLGNLQ 373

  Fly   418 TLVMSRNRLRTID--SRAFVSTNGLRHLHLDHND-IDLQQ---------PLLDI-MLQTQIN--- 466
            ||.:|.|.:...|  |....:.:.|:.|:|.||: :.||.         .|||: ..:..||   
Human   374 TLDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECPQLELLDLAFTRLHINAPQ 438

  Fly   467 SPFGYMHGLLTLNLRNNSIIFVYNDWKNTML-----QLRELDLSYNN------------------ 508
            |||..:|.|..|||     .:.:.|..|..|     .||.|:|..|:                  
Human   439 SPFQNLHFLQVLNL-----TYCFLDTSNQHLLAGLPVLRHLNLKGNHFQDGTITKTNLLQTVGSL 498

  Fly   509 ----ISSLG---YEDLAFLSQNRL-HVNMTHNKIRRIALPEDVHLGEGYNN------NLVH---- 555
                :||.|   .:..||.|..:: ||:::||.:...::....||...|.|      |::.    
Human   499 EVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSLSHLKGIYLNLAANSINIISPRLL 563

  Fly   556 --------VDLNDNPLVCDCTILWFIQLVR-GVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQI 611
                    ::|:.|||.|.|:.:.|:...: .:||.:.|       :...|:.|..|.|..:..:
Human   564 PILSQQSTINLSHNPLDCTCSNIHFLTWYKENLHKLEGS-------EETTCANPPSLRGVKLSDV 621

  Fly   612 E 612
            :
Human   622 K 622

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 24/68 (35%)
leucine-rich repeat 176..198 CDD:275380 9/25 (36%)
leucine-rich repeat 199..222 CDD:275380 7/22 (32%)
LRR_RI 216..542 CDD:238064 99/401 (25%)
LRR_8 221..281 CDD:290566 15/68 (22%)
leucine-rich repeat 223..270 CDD:275380 8/46 (17%)
leucine-rich repeat 271..294 CDD:275380 8/25 (32%)
leucine-rich repeat 295..320 CDD:275380 6/37 (16%)
leucine-rich repeat 321..343 CDD:275380 2/24 (8%)
LRR_8 342..402 CDD:290566 20/63 (32%)
leucine-rich repeat 344..367 CDD:275380 5/22 (23%)
leucine-rich repeat 368..391 CDD:275380 8/23 (35%)
LRR_8 390..450 CDD:290566 21/65 (32%)
leucine-rich repeat 392..415 CDD:275380 7/25 (28%)
leucine-rich repeat 416..439 CDD:275380 7/24 (29%)
leucine-rich repeat 440..474 CDD:275380 15/47 (32%)
leucine-rich repeat 475..498 CDD:275380 7/27 (26%)
LRR_8 477..534 CDD:290566 21/87 (24%)
leucine-rich repeat 499..520 CDD:275380 9/45 (20%)
leucine-rich repeat 523..552 CDD:275380 8/35 (23%)
LRRCT 561..619 CDD:214507 13/53 (25%)
LRRNT 631..667 CDD:214470
leucine-rich repeat 664..693 CDD:275380
LRR_8 669..726 CDD:290566
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
CD180NP_005573.2 leucine-rich repeat 38..57 CDD:275380
LRR 1 54..75