DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tl and CG42709

DIOPT Version :9

Sequence 1:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:273 Identity:60/273 - (21%)
Similarity:108/273 - (39%) Gaps:73/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 NIEEMPSHLFDD--------LENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHD 240
            ||....:|:.:.        ||:.:.::..:..|..:|.    .|||...:              
  Fly    80 NIPRRSNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPL----DMPKTAAI-------------- 126

  Fly   241 FEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRV 305
                     ||:..|.|.:|..:.||:|:...:|||:.||..|:.:.:|..::.|..:||.||| 
  Fly   127 ---------IDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANNR- 181

  Fly   306 PLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDN-LLKTLPATLLEHQVNLL 369
                                    |..:..|.|..:.::|.:.|.:| :.:.|..:.| :|.:|:
  Fly   182 ------------------------LTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFL-NQPDLV 221

  Fly   370 SLDLSNNRLTHLPDSLFAHTTNLTDLRLEDN-LLTGISGDIFSNLGNLVTLVMSR---------- 423
            .....|...|.||:..|.:.:.|..|||..| ....|:...||.|..::.|.:..          
  Fly   222 EFSCVNCSWTELPEQTFQNMSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPELEQQNIEELC 286

  Fly   424 NRLRTIDSRAFVS 436
            :.|.:||:.:|::
  Fly   287 SLLTSIDTISFLN 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 10/56 (18%)
leucine-rich repeat 176..198 CDD:275380 4/21 (19%)
leucine-rich repeat 199..222 CDD:275380 3/22 (14%)
LRR_RI 216..542 CDD:238064 53/233 (23%)
LRR_8 221..281 CDD:290566 14/59 (24%)
leucine-rich repeat 223..270 CDD:275380 8/46 (17%)
leucine-rich repeat 271..294 CDD:275380 7/22 (32%)
leucine-rich repeat 295..320 CDD:275380 6/24 (25%)
leucine-rich repeat 321..343 CDD:275380 3/21 (14%)
LRR_8 342..402 CDD:290566 17/61 (28%)
leucine-rich repeat 344..367 CDD:275380 6/23 (26%)
leucine-rich repeat 368..391 CDD:275380 6/22 (27%)
LRR_8 390..450 CDD:290566 14/58 (24%)
leucine-rich repeat 392..415 CDD:275380 9/23 (39%)
leucine-rich repeat 416..439 CDD:275380 5/31 (16%)
leucine-rich repeat 440..474 CDD:275380
leucine-rich repeat 475..498 CDD:275380
LRR_8 477..534 CDD:290566
leucine-rich repeat 499..520 CDD:275380
leucine-rich repeat 523..552 CDD:275380
LRRCT 561..619 CDD:214507
LRRNT 631..667 CDD:214470
leucine-rich repeat 664..693 CDD:275380
LRR_8 669..726 CDD:290566
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 21/103 (20%)
leucine-rich repeat 128..147 CDD:275380 7/18 (39%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR_RI <150..225 CDD:238064 23/100 (23%)
LRR_8 171..254 CDD:290566 26/108 (24%)
leucine-rich repeat 172..195 CDD:275380 9/47 (19%)
leucine-rich repeat 196..219 CDD:275380 6/23 (26%)
leucine-rich repeat 220..243 CDD:275380 6/22 (27%)
leucine-rich repeat 244..268 CDD:275380 9/23 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.