DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tl and CG32055

DIOPT Version :9

Sequence 1:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster


Alignment Length:379 Identity:106/379 - (27%)
Similarity:174/379 - (45%) Gaps:58/379 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DGLCQCAPIMSEYEIICPAN-AENPTFRLTIQPKDYVQIMCNLTD---TTDYQQLPKKLRIGEVD 100
            |.|.....:||.:..:..|| :||  ....|:|..: :.|.||..   ||:||:   .:.:||  
  Fly   133 DILAITTKLMSGFGNLVYANFSEN--LIAVIEPNAF-RHMKNLRFLDLTTNYQE---NITLGE-- 189

  Fly   101 RVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHI 165
                           .:.|.:|.|         |:|...:....||..|..|:.....:..|.|:
  Fly   190 ---------------NANLRFLSI---------SNNNLRDFQWCHLRVLPKLEELHLHSNWLEHL 230

  Fly   166 PANLLTDMRNLSHLEL-RANIEEMPSHLF---DDLENLESIEFGSNKLRQMPRGIFGKMPKLKQL 226
            ...:...:.||..|.: ..|:.|:...||   .::..||.:::.||.::.:...:|.::.||:.|
  Fly   231 DMGIFYALPNLRVLNVSNNNLFEIKRTLFMAPGEIAPLELLDYSSNIVKVLDDSVFCRLKKLRTL 295

  Fly   227 NLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDH 291
            |||.||::.:....|.|.:|:..:.:..|.|..||.||||:||.:..::||.|..:.|...:|..
  Fly   296 NLWLNQINRIHPRAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQKLGLRVFGE 360

  Fly   292 N--KHLNEVRLMNNRV----PLATLPSRLFANQPELQILRLRA-ELQSLPGDLFEHSTQITNISL 349
            .  :.|..:.|.||.:    |||      .::.|.::.||||. .|.||...:|....|:..:::
  Fly   361 RILRKLIYLDLSNNYIADLHPLA------LSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTI 419

  Fly   350 GDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLR---LEDN 400
            .:|.|:.:...:|:....|..|:|:|||||.|||  ...:.||..||   ||.|
  Fly   420 NENRLEEIDGEILDTLDRLNHLELNNNRLTFLPD--LKSSQNLLQLRNITLEGN 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566 19/62 (31%)
leucine-rich repeat 176..198 CDD:275380 6/25 (24%)
leucine-rich repeat 199..222 CDD:275380 5/22 (23%)
LRR_RI 216..542 CDD:238064 65/195 (33%)
LRR_8 221..281 CDD:290566 24/59 (41%)
leucine-rich repeat 223..270 CDD:275380 19/46 (41%)
leucine-rich repeat 271..294 CDD:275380 5/24 (21%)
leucine-rich repeat 295..320 CDD:275380 7/28 (25%)
leucine-rich repeat 321..343 CDD:275380 8/22 (36%)
LRR_8 342..402 CDD:290566 22/62 (35%)
leucine-rich repeat 344..367 CDD:275380 3/22 (14%)
leucine-rich repeat 368..391 CDD:275380 11/22 (50%)
LRR_8 390..450 CDD:290566 7/14 (50%)
leucine-rich repeat 392..415 CDD:275380 6/12 (50%)
leucine-rich repeat 416..439 CDD:275380
leucine-rich repeat 440..474 CDD:275380
leucine-rich repeat 475..498 CDD:275380
LRR_8 477..534 CDD:290566
leucine-rich repeat 499..520 CDD:275380
leucine-rich repeat 523..552 CDD:275380
LRRCT 561..619 CDD:214507
LRRNT 631..667 CDD:214470
leucine-rich repeat 664..693 CDD:275380
LRR_8 669..726 CDD:290566
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566 14/49 (29%)
leucine-rich repeat 128..147 CDD:275380 4/13 (31%)
leucine-rich repeat 148..171 CDD:275380 7/25 (28%)
leucine-rich repeat 172..192 CDD:275380 7/39 (18%)
LRR_RI <187..400 CDD:238064 63/244 (26%)
LRR_8 192..251 CDD:290566 14/67 (21%)
leucine-rich repeat 193..216 CDD:275380 8/31 (26%)
leucine-rich repeat 217..240 CDD:275380 3/22 (14%)
leucine-rich repeat 241..267 CDD:275380 6/25 (24%)
leucine-rich repeat 268..291 CDD:275380 5/22 (23%)
LRR_8 290..350 CDD:290566 24/59 (41%)
leucine-rich repeat 292..315 CDD:275380 9/22 (41%)
leucine-rich repeat 316..339 CDD:275380 9/22 (41%)
LRR_8 340..400 CDD:290566 17/65 (26%)
leucine-rich repeat 340..365 CDD:275380 5/24 (21%)
leucine-rich repeat 366..389 CDD:275380 7/28 (25%)
leucine-rich repeat 390..413 CDD:275380 8/22 (36%)
LRR_8 391..448 CDD:290566 17/56 (30%)
leucine-rich repeat 414..437 CDD:275380 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.