DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tl and IL1RAPL2

DIOPT Version :9

Sequence 1:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster
Sequence 2:NP_059112.1 Gene:IL1RAPL2 / 26280 HGNCID:5997 Length:686 Species:Homo sapiens


Alignment Length:326 Identity:79/326 - (24%)
Similarity:137/326 - (42%) Gaps:55/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   807 IALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKKFDAFISYSHKDQS 871
            |.||..:....||......:|..:..|:.::...|     |..:|..|.:|::||::||:..||.
Human   355 IELAGGLGAIFLLLVLLVVIYKCYNIELMLFYRQH-----FGADETNDDNKEYDAYLSYTKVDQD 414

  Fly   872 FI-------EDY---LVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFI 926
            .:       |.:   ::|.:......::|.:.|||.:..|...|::.|.|..|||.||||:.::|
Human   415 TLDCDNPEEEQFALEVLPDVLEKHYGYKLFIPERDLIPSGTYMEDLTRYVEQSRRLIIVLTPDYI 479

  Fly   927 -KSEWARLEFRAAHRSALNEGRSRIIVIIYSDI-GDVEKLD-EELKAYLKMNTYLKWG------- 981
             :..|:..|..:...:.|..|..::|:|..::: |.|...: |.||..:|:.:.:||.       
Human   480 LRRGWSIFELESRLHNMLVSGEIKVILIECTELKGKVNCQEVESLKRSIKLLSLIKWKGSKSSKL 544

  Fly   982 DPWFWDKLRFALPHRRPVGNIGNGALIKTALKGSTDDKL--ELIKPSPVTPPLTTPPAEATKNPL 1044
            :..||..|.:.:|.::      ...|.:..:..|.:..|  ||   .|: |.:......||....
Human   545 NSKFWKHLVYEMPIKK------KEMLPRCHVLDSAEQGLFGEL---QPI-PSIAMTSTSATLVSS 599

  Fly  1045 VAQLNGVTPHQAIMIANGKNG------LTNLYTPNGKSHGNGH---------INGAFIINTNAKQ 1094
            .|.|....|..::.|.:...|      .|.|..|   |.||.|         :||...:|...|.
Human   600 QADLPEFHPSDSMQIRHCCRGYKHEIPATTLPVP---SLGNHHTYCNLPLTLLNGQLPLNNTLKD 661

  Fly  1095 S 1095
            :
Human   662 T 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TlNP_001262995.1 LRR_8 174..233 CDD:290566
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
LRR_RI 216..542 CDD:238064
LRR_8 221..281 CDD:290566
leucine-rich repeat 223..270 CDD:275380
leucine-rich repeat 271..294 CDD:275380
leucine-rich repeat 295..320 CDD:275380
leucine-rich repeat 321..343 CDD:275380
LRR_8 342..402 CDD:290566
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 368..391 CDD:275380
LRR_8 390..450 CDD:290566
leucine-rich repeat 392..415 CDD:275380
leucine-rich repeat 416..439 CDD:275380
leucine-rich repeat 440..474 CDD:275380
leucine-rich repeat 475..498 CDD:275380
LRR_8 477..534 CDD:290566
leucine-rich repeat 499..520 CDD:275380
leucine-rich repeat 523..552 CDD:275380
LRRCT 561..619 CDD:214507
LRRNT 631..667 CDD:214470
leucine-rich repeat 664..693 CDD:275380
LRR_8 669..726 CDD:290566
leucine-rich repeat 694..715 CDD:275380
leucine-rich repeat 716..737 CDD:275380
LRRCT 751..800 CDD:214507
TIR 858..996 CDD:214587 42/157 (27%)
IL1RAPL2NP_059112.1 Ig 32..133 CDD:325142
Ig2_IL1R_like 146..237 CDD:319309
IG_like 250..347 CDD:214653
TIR 402..563 CDD:307630 42/166 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8062
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.