DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14247 and CG6403

DIOPT Version :9

Sequence 1:NP_651502.2 Gene:CG14247 / 43221 FlyBaseID:FBgn0039454 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001287549.1 Gene:CG6403 / 43220 FlyBaseID:FBgn0039453 Length:153 Species:Drosophila melanogaster


Alignment Length:160 Identity:52/160 - (32%)
Similarity:74/160 - (46%) Gaps:11/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLILILTMLQLLQQGVAATTDPDTTTNATCRHATDMWGDPDPNIFYVCSDGGQPLQLECPPGRGF 88
            :|..::....:|..|.||:....:..:..|:...::||..|...||.|.| |:.:..||..|..|
  Fly     1 MLKALIIFFGILALGYAASVGTASDASEVCQSQDELWGGEDIRKFYFCLD-GKVIADECDSGYYF 64

  Fly    89 FSGLGYLGCLPYDHW-PACRPSEEQVAAQLSAGCDTTTGIVPSPWASPDPNRFYLCPSINATPLL 152
            .:.....||||.|.. |:|...:.:|     ..|..|:.:  .|.|:.|...||||.|..||  |
  Fly    65 VNNATISGCLPSDLMKPSCVNLDTKV-----PDCTGTSKL--QPQAADDVASFYLCTSEGAT--L 120

  Fly   153 LNCAAGSGFVSSSEVVGCADWSQWRRQMEC 182
            |:|..|..|||....:||..||:||....|
  Fly   121 LSCPDGKAFVSQDGYLGCFAWSEWRSLRNC 150



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7Z9
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.