DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yif1 and AT3G59500

DIOPT Version :9

Sequence 1:NP_651498.1 Gene:Yif1 / 43217 FlyBaseID:FBgn0039450 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001326775.1 Gene:AT3G59500 / 825119 AraportID:AT3G59500 Length:269 Species:Arabidopsis thaliana


Alignment Length:321 Identity:78/321 - (24%)
Similarity:136/321 - (42%) Gaps:73/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NSYGFDPNLGQPSQHIQQPPQQQPGYGYGAPPPQQAAGPPTYGIGAPQPVAPPTGQYPQFAMFQQ 136
            |:.|..|.:..|    |..||..|   :|.|.....:|....|:||                   
plant     3 NNMGPRPGMAMP----QANPQPSP---FGNPFSGPGSGLIRSGLGA------------------- 41

  Fly   137 PIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKLRLLFFPYMHKDWSLR 201
                     ||:|:.....:.:::...::  .:..:|||.|::.||..||:::..|::|:....|
plant    42 ---------YGEKIFGSSSEYVQSNISRY--FSDPQYYFQVNDQYVRNKLKIVLLPFLHRGHWTR 95

  Fly   202 YDQEHPV-------QPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPEQLGIQASSAMAYS 259
            ..:  ||       .|.||:||||||:|.|.:.|||::|||.||:..:|:||.|.......|...
plant    96 ISE--PVGGRLSYKPPIYDINAPDLYIPLMAFGTYVVLAGLSLGLYGKFTPEALNWLFVKGMVGW 158

  Fly   260 IFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMV-STLFFKSGYYIALAYTSFSFGF 323
            ..::::..:.|..:. ......||::|:.||.:..:  ||.| ..:.:...||:.:.:|....|.
plant   159 FLQVMLLKITLLSLG-SGEAPLLDIVAYAGYTFTGL--CLAVLGKIIWGYSYYVLIPWTCLCTGV 220

  Fly   324 FMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQFDYSGGKKRKLYFLFMIVAGQALFAFLL 384
            |:::|::..|..::.        :||             ..|..|.|..:...|  |..|:
plant   221 FLVKTMKRVLFAESR--------SYD-------------SSRHHYLLIFVALAQ--FPLLI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yif1NP_651498.1 YIF1 142..383 CDD:281822 63/248 (25%)
AT3G59500NP_001326775.1 Nucleoporin_FG2 <14..57 CDD:374260 14/77 (18%)
YIF1 42..261 CDD:367709 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I2356
eggNOG 1 0.900 - - E1_COG5197
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H60114
Inparanoid 1 1.050 102 1.000 Inparanoid score I2158
OMA 1 1.010 - - QHG55435
OrthoDB 1 1.010 - - D1256839at2759
OrthoFinder 1 1.000 - - FOG0002277
OrthoInspector 1 1.000 - - otm2969
orthoMCL 1 0.900 - - OOG6_101876
Panther 1 1.100 - - LDO PTHR14083
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1506
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.