DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and PRB1

DIOPT Version :9

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_010854.1 Gene:PRB1 / 856649 SGDID:S000000786 Length:635 Species:Saccharomyces cerevisiae


Alignment Length:326 Identity:74/326 - (22%)
Similarity:126/326 - (38%) Gaps:61/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDN 251
            |:.||:.::|.||:..|.|  |...|........||       .|...|.|||.|||.:|:..  
Yeast   316 GRGVTSYVIDTGVNINHKD--FEKRAIWGKTIPLND-------EDLDGNGHGTHCAGTIASKH-- 369

  Fly   252 GICGVGVAYDSKIAGIRML---DQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVD----G 309
                .|||.::.:..:::|   ....|:|:::......:.|:........|  ..|.|.:    |
Yeast   370 ----YGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKG--FKGSTANMSLGG 428

  Fly   310 PRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDE 374
            .::..:...|....|    :|..:..|:|: ..:|.||....:|.. .|::.::......|::..
Yeast   429 GKSPALDLAVNAAVE----VGIHFAVAAGN-ENQDACNTSPASADK-AITVGASTLSDDRAYFSN 487

  Fly   375 --SCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANP------- 430
              .|    ...|:.|....:|.:.:.|    .|.|.||||.|:|..||:....|...|       
Yeast   488 WGKC----VDVFAPGLNILSTYIGSDD----ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFF 544

  Fly   431 -----QLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVTLSKQWH 490
                 .||.:.::...:..|.::.|||....   |.|.:      ::..|..|..|....:|:.|
Yeast   545 ELGQDSLTPQQLKKKLIHYSTKDILFDIPED---TPNVL------IYNGGGQDLSAFWNDTKKSH 600

  Fly   491 S 491
            |
Yeast   601 S 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789 62/279 (22%)
Peptidase_S8 187..459 CDD:278510 66/292 (23%)
Peptidases_S8_S53 <409..485 CDD:299169 21/87 (24%)
P_proprotein 534..621 CDD:279782
PRB1NP_010854.1 Inhibitor_I9 182..278 CDD:399132
Peptidases_S8_PCSK9_ProteinaseK_like 290..566 CDD:173790 63/280 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.