DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and RRT12

DIOPT Version :9

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_009974.1 Gene:RRT12 / 850412 SGDID:S000000641 Length:491 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:74/295 - (25%)
Similarity:109/295 - (36%) Gaps:80/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEV------ 245
            |::|...|||.|:...||:  |........|.:...      :.|.  |.|||..||.|      
Yeast   165 GQDVNAYIMDTGIFADHPE--FEDRVIQGIDLTKEG------FGDQ--NGHGTHVAGLVGSKTYG 219

  Fly   246 AAARDN-------GICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDD 303
            ||.|.|       |..|.|.| .:.::|:..:.:       ....:.....|..:.:.|.|..  
Yeast   220 AAKRVNLVEVKVLGKDGSGEA-SNVLSGLEFIVE-------HCTKVSRPQGKKCVANLSLGSF-- 274

  Fly   304 GKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQ 368
                   |:..:...|:|..|.    |.::|.|:|      :.|.|.|.||  ..|..:.|..|.
Yeast   275 -------RSPIINMAVEGAIEE----GIVFVAAAG------NFNLDAYWAS--PASAENVITVGA 320

  Fly   369 -NAHYDESCSSTLASTFSNGAKDPN---TGVATTDL----YGKCTTTHSGTSAAAPEAAGVFALA 425
             :.|.|     |:|. |||.....|   .||....|    |.. |...||||.:.|...||.|:.
Yeast   321 FDDHID-----TIAK-FSNWGPCVNIFAPGVEIESLSHLNYND-TLILSGTSMSTPIVTGVAAIL 378

  Fly   426 LE--ANPQLTWRDIQHLTVLTSKRNSLFDAKNRFH 458
            |.  ..|::..::|::|:           .:|.||
Yeast   379 LSKGIEPEMIAQEIEYLS-----------TRNVFH 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789 71/281 (25%)
Peptidase_S8 187..459 CDD:278510 74/295 (25%)
Peptidases_S8_S53 <409..485 CDD:299169 15/52 (29%)
P_proprotein 534..621 CDD:279782
RRT12NP_009974.1 Peptidases_S8_PCSK9_ProteinaseK_like 130..398 CDD:173790 71/289 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.