DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and RSPO3

DIOPT Version :9

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_116173.2 Gene:RSPO3 / 84870 HGNCID:20866 Length:272 Species:Homo sapiens


Alignment Length:59 Identity:17/59 - (28%)
Similarity:25/59 - (42%) Gaps:7/59 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 IEANSMGHEPHKI-HIYSASWGP----TDDGKTVDGPRNATMRAIVQGVNEGRNGLGNI 332
            :|||:...|...| |...:.|.|    |..|||....|....|  |:.:.:..:..||:
Human   133 LEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETR--VREIIQHPSAKGNL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789 17/59 (29%)
Peptidase_S8 187..459 CDD:278510 17/59 (29%)
Peptidases_S8_S53 <409..485 CDD:299169
P_proprotein 534..621 CDD:279782
RSPO3NP_116173.2 FU 1 35..86
Furin-like_2 42..143 CDD:374219 4/9 (44%)
FU 2 92..135 0/1 (0%)
TSP1 150..202 CDD:214559 11/42 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.