DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and PCSK5

DIOPT Version :9

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001358972.1 Gene:PCSK5 / 5125 HGNCID:8747 Length:1887 Species:Homo sapiens


Alignment Length:624 Identity:270/624 - (43%)
Similarity:364/624 - (58%) Gaps:59/624 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VFTSSFLVRFRRGVDNSFAHDVADKYGFDNLGPLVGADGHEYHFKH-RTLPHARSRRSLTHTRAL 102
            |:|:.:.|:...|...  |:.:|.||||.|:|. :||....|||.| ||:     :||:..:|..
Human    34 VYTNHWAVKIAGGFPE--ANRIASKYGFINIGQ-IGALKDYYHFYHSRTI-----KRSVISSRGT 90

  Fly   103 KS----HPAVHTAVQQPGFKRVKRGLRPAVPAIHGMKFDLKVGEGNRIDEEPTDPYFPMQWYLKN 163
            .|    .|.|....||...||.||            .:|....:....:    ||.:|..||: :
Human    91 HSFISMEPKVEWIQQQVVKKRTKR------------DYDFSRAQSTYFN----DPKWPSMWYM-H 138

  Fly   164 TGQNGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPR 228
            ...|....:.|:|::.||.:|.||||:...|:|||::..||||..||:|.||.|.:.||..|.||
Human   139 CSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPR 203

  Fly   229 YTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHI 293
            |.....|.||||||||||||.:|..|.||:|:::||.|:||||.. :||::||.|:...|..:||
Human   204 YDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGD-VTDMVEAKSVSFNPQHVHI 267

  Fly   294 YSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGG-EEDDCNCDGYAASMWT 357
            |||||||.|||||||||...|.:|...||..||.|||:::|||||:|| .:|.|:||||..|::|
Human   268 YSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYT 332

  Fly   358 ISINSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVF 422
            |||:|....|:...|.|.||||||:|:|:| :..:..:.||||..:||..|:||||:||.|||:.
Human   333 ISISSTAESGKKPWYLEECSSTLATTYSSG-ESYDKKIITTDLRQRCTDNHTGTSASAPMAAGII 396

  Fly   423 ALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVTLSK 487
            ||||||||.|||||:||:.|.||:...|    |...|..|..|.:.:||:|||::||.|||..::
Human   397 ALALEANPFLTWRDVQHVIVRTSRAGHL----NANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAE 457

  Fly   488 QWHSVPPRYHCEAG-----ELTQPQAIVMGRSLFWEIKTDACK-GTDTEVNYLEHVQAVISANAS 546
            :|.:||.::.|...     :..:|.:.|  ||::   |...|. ..:..|||||||...|:....
Human   458 KWTTVPRQHVCVESTDRQIKTIRPNSAV--RSIY---KASGCSDNPNRHVNYLEHVVVRITITHP 517

  Fly   547 RRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKLEARFNSPQTRH 611
            |||||.::||||.||:|.:|:.|..|.. .:||..|.|||.|.|||...|.|.||......|.|:
Human   518 RRGDLAIYLTSPSGTRSQLLANRLFDHS-MEGFKNWEFMTIHCWGERAAGDWVLEVYDTPSQLRN 581

  Fly   612 ----GNLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVKK 646
                |.|.||||||:||...||      ||.::...|::
Human   582 FKTPGKLKEWSLVLYGTSVQPY------SPTNEFPKVER 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079 28/83 (34%)
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789 157/296 (53%)
Peptidase_S8 187..459 CDD:278510 148/272 (54%)
Peptidases_S8_S53 <409..485 CDD:299169 42/75 (56%)
P_proprotein 534..621 CDD:279782 42/90 (47%)
PCSK5NP_001358972.1 S8_pro-domain 38..114 CDD:374560 28/83 (34%)
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 126..420 CDD:173789 157/300 (52%)
P_proprotein 505..595 CDD:366670 42/90 (47%)
Cell attachment site. /evidence=ECO:0000255 519..521 1/1 (100%)
FU 1 630..680
GF_recep_IV 635..744 CDD:373332
VSP 724..1100 CDD:146106
FU 1084..1129 CDD:238021
FU 1126..1162 CDD:214589
FU 1209..1256 CDD:238021
VSP 1291..>1576 CDD:146106
GF_recep_IV 1596..1713 CDD:373332
FU 1695..1736 CDD:214589
AC 1. /evidence=ECO:0000250 1834..1853
AC 2. /evidence=ECO:0000250 1865..1887
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311719at33208
OrthoFinder 1 1.000 - - FOG0000204
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.