DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and S1P

DIOPT Version :9

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_649337.2 Gene:S1P / 40399 FlyBaseID:FBgn0037105 Length:1012 Species:Drosophila melanogaster


Alignment Length:404 Identity:87/404 - (21%)
Similarity:141/404 - (34%) Gaps:120/404 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LKSHPAVHTAVQQPGFKRVKRGLRPAVPAIHGMKFDLKVGEGNRIDEEPTDPYFPMQWYLKNTGQ 166
            |::||:|...|.|...:|:             :.:| .......|...|       |..|:|...
  Fly    93 LQTHPSVKAVVPQRSVRRI-------------LNYD-AYSNLTYIHRHP-------QGVLRNRNP 136

  Fly   167 NGGKVR-----LDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDL-----KFNYNAEASYDFSSN 221
            |..:.|     |..|:  .|..|||||.|..||.|.|:...||..     :.|:..|.|.|... 
  Fly   137 NNDRHRQLCSVLHANI--LWKLGITGKGVKVAIFDTGLTKNHPHFRNVKERTNWTNEKSLDDRV- 198

  Fly   222 DPFPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQ---PYMTDLIEANS 283
                          ||||..||.:|::|:   | :|.|.|:.:...::...   .|.:..::|.:
  Fly   199 --------------SHGTFVAGVIASSRE---C-LGFAPDADLYIFKVFTNSQVSYTSWFLDAFN 245

  Fly   284 MGHEPHKIHIYSASWGPTD--DGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDC 346
            .... .||:|.:.|.|..|  |...|:.....:...::.....|.:  |.:|...:..|.:.|..
  Fly   246 YAIY-RKINILNLSIGGPDFMDSPFVEKVLELSANNVIMISAAGND--GPLYGTLNNPGDQSDVV 307

  Fly   347 NCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDL---YGK----- 403
            ...|                   ..:|:..           ||..:.|:.|.:|   ||:     
  Fly   308 GVGG-------------------IQFDDKI-----------AKFSSRGMTTWELPLGYGRMGLDI 342

  Fly   404 ---------------CTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDA 453
                           |... ||||.::|..||..||.:..    .::.|.::...:.|:..:..|
  Fly   343 VTYGSQVEGSDVRKGCRRL-SGTSVSSPVVAGAAALLISG----AFQKIDYINPASLKQVLIEGA 402

  Fly   454 KNRFHWTM--NGVG 465
            :...|:.|  .|.|
  Fly   403 EKLPHYNMFEQGAG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079 7/19 (37%)
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789 72/333 (22%)
Peptidase_S8 187..459 CDD:278510 62/304 (20%)
Peptidases_S8_S53 <409..485 CDD:299169 16/59 (27%)
P_proprotein 534..621 CDD:279782
S1PNP_649337.2 Peptidases_S8_SKI-1_like 154..407 CDD:173805 66/309 (21%)
Peptidase_S8 160..416 CDD:278510 65/312 (21%)
DUF4350 610..673 CDD:290957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.