DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and RSPO2

DIOPT Version :9

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:XP_011515320.1 Gene:RSPO2 / 340419 HGNCID:28583 Length:250 Species:Homo sapiens


Alignment Length:65 Identity:15/65 - (23%)
Similarity:21/65 - (32%) Gaps:15/65 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 HWTMNGVGLEFNHLFGF--------------GVLDAGAMVTLSKQWHSVPPRYHCEAGELTQPQA 508
            ||:..|.....|...||              .|.|.....|:::.........||..|:.| |:|
Human   156 HWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRT-PKA 219

  Fly   509  508
            Human   220  219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789