DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and Rspo1

DIOPT Version :9

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001101450.1 Gene:Rspo1 / 313589 RGDID:1565558 Length:262 Species:Rattus norvegicus


Alignment Length:130 Identity:25/130 - (19%)
Similarity:40/130 - (30%) Gaps:38/130 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 WGPTDDGKTVDGPRNA----TMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTI 358
            |||....:.:.|.|..    |.|.:                  ...||::.:|: |.......|:
  Rat   156 WGPCSKKRKLCGFRKGSEERTRRVL------------------HAPGGDQTNCS-DTKETRKCTV 201

  Fly   359 SINSAINDGQ---NAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAG 420
            . .:...:||   .|......::....|..| :|:|          |..:..|.|.....|..||
  Rat   202 R-RTPCPEGQKRKKASQGRRENANRHPTRKN-SKEP----------GSNSRRHKGQQQPQPGTAG 254

  Fly   421  420
              Rat   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789 25/130 (19%)
Peptidase_S8 187..459 CDD:278510 25/130 (19%)
Peptidases_S8_S53 <409..485 CDD:299169 4/12 (33%)
P_proprotein 534..621 CDD:279782
Rspo1NP_001101450.1 Furin-like_2 42..144 CDD:292535
FU 100..142 CDD:238021
TSP_1 <151..216 CDD:301595 14/79 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.