DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and Pcsk9

DIOPT Version :9

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_954862.2 Gene:Pcsk9 / 298296 RGDID:728909 Length:691 Species:Rattus norvegicus


Alignment Length:295 Identity:69/295 - (23%)
Similarity:110/295 - (37%) Gaps:62/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 AWAQ--------GITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSS---NDPFPYPRYTDDW 233
            ||.|        |  ...|...::|..:...|.:::......   ||:|   .|...:.|.... 
  Rat   163 AWQQTEEDSSPDG--SSQVEVYLLDTSIQSGHREIEGRVTIT---DFNSVPEEDGTRFHRQASK- 221

  Fly   234 FNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLD-QPYMTDLIEANSMGHE-PHKIHIYSA 296
            .:||||..|| |.:.||     .|||..:.:..:|:|: |...|  :....:|.| ..|..:...
  Rat   222 CDSHGTHLAG-VVSGRD-----AGVAKGTSLHSLRVLNCQGKGT--VSGTLIGLEFIRKSQLIQP 278

  Fly   297 SWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISIN 361
            | ||......:.|..:..:....|.:  .|.|:    |..:..|...||......|::...|::.
  Rat   279 S-GPLVVLLPLAGGYSRILNTACQRL--ARTGV----VLVAAAGNFRDDACLYSPASAPEVITVG 336

  Fly   362 SAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLY--GK-----------CTTTHSGTSA 413
            :.     ||........||.:.|..          ..||:  ||           |..:.||||.
  Rat   337 AT-----NAQDQPVTLGTLGTNFGR----------CVDLFAPGKDIIGASSDCSTCYMSQSGTSQ 386

  Fly   414 AAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRN 448
            ||...||:.|:.|..:|.||..:::...:|.|.::
  Rat   387 AAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789 68/291 (23%)
Peptidase_S8 187..459 CDD:278510 65/280 (23%)
Peptidases_S8_S53 <409..485 CDD:299169 15/40 (38%)
P_proprotein 534..621 CDD:279782
Pcsk9NP_954862.2 Inhibitor_I9 76..148 CDD:283552
Peptidases_S8_PCSK9_ProteinaseK_like 155..420 CDD:173790 69/292 (24%)
Peptidase_S8 179..415 CDD:278510 63/269 (23%)
C-terminal domain. /evidence=ECO:0000250 449..691
Cell attachment site. /evidence=ECO:0000255 495..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.