DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and PCSK9

DIOPT Version :9

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_777596.2 Gene:PCSK9 / 255738 HGNCID:20001 Length:692 Species:Homo sapiens


Alignment Length:319 Identity:73/319 - (22%)
Similarity:123/319 - (38%) Gaps:68/319 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 RIDE-EPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAAWAQGITGKNVTTAI----MDDGVDYMHP 204
            |.|| :|.|....::.||           ||.::|:...: |.|:.:.|..    .:||.     
Human   167 RADEYQPPDGGSLVEVYL-----------LDTSIQSDHRE-IEGRVMVTDFENVPEEDGT----- 214

  Fly   205 DLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRM 269
                .::.:||.                 .:||||..|| |.:.||     .|||..:.:..:|:
Human   215 ----RFHRQASK-----------------CDSHGTHLAG-VVSGRD-----AGVAKGASMRSLRV 252

  Fly   270 LD-QPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIY 333
            |: |...|  :....:|.|..:........||......:.|..:..:.|..|.:  .|.|:    
Human   253 LNCQGKGT--VSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRL--ARAGV---- 309

  Fly   334 VWASGDGGEEDDCNCDGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAK--DPNTGV- 395
            |..:..|...||......|::...|::.:.     ||........||.:.|.....  .|...: 
Human   310 VLVTAAGNFRDDACLYSPASAPEVITVGAT-----NAQDQPVTLGTLGTNFGRCVDLFAPGEDII 369

  Fly   396 -ATTDLYGKCTTTHSGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDA 453
             |::|. ..|..:.||||.||...||:.|:.|.|.|:||..:::...:..|.::.:.:|
Human   370 GASSDC-STCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEA 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 150..446 CDD:173789 68/304 (22%)
Peptidase_S8 187..459 CDD:278510 62/276 (22%)
Peptidases_S8_S53 <409..485 CDD:299169 16/45 (36%)
P_proprotein 534..621 CDD:279782
PCSK9NP_777596.2 Inhibitor_I9 77..149 CDD:283552
Peptidases_S8_PCSK9_ProteinaseK_like 156..421 CDD:173790 72/311 (23%)
Peptidase_S8 180..422 CDD:278510 67/299 (22%)
C-terminal domain 450..692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.