DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amon and Rspo1

DIOPT Version :10

Sequence 1:NP_477318.1 Gene:amon / 43215 FlyBaseID:FBgn0023179 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_619624.2 Gene:Rspo1 / 192199 MGIID:2183426 Length:265 Species:Mus musculus


Alignment Length:69 Identity:13/69 - (18%)
Similarity:23/69 - (33%) Gaps:13/69 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 PQGTWKLEARFNSPQTRHGNLLEWSL------------VLHGTKEAPYRTLH-PSSPHSKLAIVK 645
            |:|:....:...........:.|||.            ...|::|...|.|| |...|:..:..|
Mouse   130 PEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRKGSEERTRRVLHAPGGDHTTCSDTK 194

  Fly   646 KAHE 649
            :..:
Mouse   195 ETRK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amonNP_477318.1 S8_pro-domain 43..122 CDD:465126
Peptidases_S8_Protein_convertases_Kexins_Fur in-lik 150..446 CDD:173789
Peptidases_S8_S53 <409..485 CDD:415849
P_proprotein 534..621 CDD:460225 5/38 (13%)
Rspo1NP_619624.2 FU 1 34..85
Furin-like_2 42..142 CDD:464939 2/11 (18%)
FU 2 91..135 2/4 (50%)
TSP1_spondin 148..203 CDD:480609 11/51 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..192 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..265
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.