DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment amon and Rspo1

DIOPT Version :9

Sequence 1:	NP_477318.1	Gene:	amon / 43215	FlyBaseID:	FBgn0023179	Length:	654	Species:	Drosophila melanogaster
Sequence 2:	NP_619624.2	Gene:	Rspo1 / 192199	MGIID:	2183426	Length:	265	Species:	Mus musculus

Alignment Length:	69	Identity:	13/69 - (18%)
Similarity:	23/69 - (33%)	Gaps:	13/69 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   594 PQGTWKLEARFNSPQTRHGNLLEWSL------------VLHGTKEAPYRTLH-PSSPHSKLAIVK 645
            |:|:....:...........:.|||.            ...|::|...|.|| |...|:..:..|
Mouse   130 PEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRKGSEERTRRVLHAPGGDHTTCSDTK 194

  Fly   646 KAHE 649
            :..:
Mouse   195 ETRK 198

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
amon	NP_477318.1	S8_pro-domain	43..122	CDD:293079
		Peptidases_S8_Protein_convertases_Kexins_Fur in-like	150..446	CDD:173789
		Peptidase_S8	187..459	CDD:278510
		Peptidases_S8_S53	<409..485	CDD:299169
		P_proprotein	534..621	CDD:279782	5/38 (13%)
Rspo1	NP_619624.2	FU 1	34..85
		Furin-like_2	42..144	CDD:292535	2/13 (15%)
		FU 2	91..135		2/4 (50%)
		FU	100..142	CDD:238021	2/11 (18%)
		TSP_1	<151..208	CDD:301595	11/48 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	173..192		6/18 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..265
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1404
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900