DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment amon and LOC100330575

DIOPT Version :9

Sequence 1:	NP_477318.1	Gene:	amon / 43215	FlyBaseID:	FBgn0023179	Length:	654	Species:	Drosophila melanogaster
Sequence 2:	XP_002666956.3	Gene:	LOC100330575 / 100330575	-ID:	-	Length:	983	Species:	Danio rerio

Alignment Length:	70	Identity:	20/70 - (28%)
Similarity:	30/70 - (42%)	Gaps:	13/70 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   460 TMN-GVGLEFNHLFGFGVLDAGAMV--------TLSKQWHSVPPRY-HCEAGELTQPQAIVM--- 511
            ||| |:.|......|||::::|:.:        .|..|..|..|.. .||..||.:..|..:
Zfish    12 TMNAGLTLFVFSFCGFGLIESGSSLLSCPSGQFPLKNQCVSCHPTCGECEGHELFECTACALDED 76

  Fly   512 GRSLF 516
            |:..|
Zfish    77 GKERF 81

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
amon	NP_477318.1	S8_pro-domain	43..122	CDD:293079
		Peptidases_S8_Protein_convertases_Kexins_Fur in-like	150..446	CDD:173789
		Peptidase_S8	187..459	CDD:278510
		Peptidases_S8_S53	<409..485	CDD:299169	9/33 (27%)
		P_proprotein	534..621	CDD:279782
LOC100330575	XP_002666956.3	GF_recep_IV	258..355	CDD:291509
		FU	301..349	CDD:238021
		Furin-like_2	<327..390	CDD:292535
		FU	494..542	CDD:238021
		FU	595..637	CDD:214589
		GF_recep_IV	599..717	CDD:291509
		FU	651..693	CDD:214589
		FU	698..742	CDD:214589
		FU	745..789	CDD:214589
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D311719at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010