powered by:
Protein Alignment amon and LOC100330575
DIOPT Version :9
Sequence 1: | NP_477318.1 |
Gene: | amon / 43215 |
FlyBaseID: | FBgn0023179 |
Length: | 654 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002666956.3 |
Gene: | LOC100330575 / 100330575 |
-ID: | - |
Length: | 983 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 20/70 - (28%) |
Similarity: | 30/70 - (42%) |
Gaps: | 13/70 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 460 TMN-GVGLEFNHLFGFGVLDAGAMV--------TLSKQWHSVPPRY-HCEAGELTQPQAIVM--- 511
||| |:.|......|||::::|:.: .|..|..|..|.. .||..||.:..|..:
Zfish 12 TMNAGLTLFVFSFCGFGLIESGSSLLSCPSGQFPLKNQCVSCHPTCGECEGHELFECTACALDED 76
Fly 512 GRSLF 516
|:..|
Zfish 77 GKERF 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D311719at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.