DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VII and CD80

DIOPT Version :9

Sequence 1:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_005182.1 Gene:CD80 / 941 HGNCID:1700 Length:288 Species:Homo sapiens


Alignment Length:200 Identity:47/200 - (23%)
Similarity:77/200 - (38%) Gaps:53/200 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ATFKCTHNVRPEIL--FKVTWLKVDKGKFFEFINGRN---PPFRNSTIEGAEIDWDNSNEQQVTL 100
            ||..|.|||..|.|  .::.|.| :|......::|..   |.::|.||      :|.:|...:.:
Human    46 ATLSCGHNVSVEELAQTRIYWQK-EKKMVLTMMSGDMNIWPEYKNRTI------FDITNNLSIVI 103

  Fly   101 KDVQFDLSGQFYCEV-STDTPIFTKAS-ADELMSVFLPQTGP-------PTIKFRKRTPFAVGEK 156
            ..::....|.:.|.| ..:...|.:.. |:..:||......|       ||...|:         
Human   104 LALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVK
ADFPTPSISDFEIPTSNIRR--------- 159

  Fly   157 LFALCNTTRGRPAPHITWLINGKKVE---------------------DRYVRTHHVFSFNGKHQH 200
              .:|:|:.|.|.||::||.||:::.                     |..:.|:|.|....|:.|
Human   160 --IICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGH 222

  Fly   201 QRRTQ 205
            .|..|
Human   223 LRVNQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VIINP_733162.2 Ig 31..118 CDD:299845 21/82 (26%)
IG_like 34..118 CDD:214653 21/82 (26%)
Ig 141..>183 CDD:299845 13/62 (21%)
CD80NP_005182.1 IgV_CD80 35..139 CDD:319335 24/99 (24%)
IgC_CD80 142..232 CDD:319332 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D8C9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083437at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.