DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VII and beat-VI

DIOPT Version :9

Sequence 1:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster


Alignment Length:261 Identity:67/261 - (25%)
Similarity:106/261 - (40%) Gaps:56/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WII--ALLLGLQQTKPINGQSDVLVNLVVPRYVERGSSATFKCTHNVRPEILFKVTWLKVDKGKF 67
            |||  .|||.....|.:        .:.||..|..|::||..|.:::....|:.|.|. ..:.:|
  Fly    39 WIIISELLLSAHCLKDL--------KIFVPEAVLMGNAATLSCQYDLEQAALYAVRWY-FGQEEF 94

  Fly    68 FEFINGRNPPFRNSTIEGAEIDWDNSNEQQVTLKDVQFDLSGQFYCEVSTDTPIF-TKASADELM 131
            :.::.....|.....:.|..:|..||:...||||.|..:|||.:.||||.|.|:| |:..:..:.
  Fly    95 YRYVPREAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAHMQ 159

  Fly   132 SVFLPQTGPPTIKFRKRTPFAVGEKLFALCNTTRGRPAPHITWLINGKKVEDRYVRTHHVFSFNG 196
            .:.||: ..|.::..|:. ..|.:...|:|......|..:|||.|||.::               
  Fly   160 VIELPK-DDPVMQVDKKV-IGVNDNFKAVCTVGPSYPPANITWSINGNQI--------------- 207

  Fly   197 KHQHQRRTQQQQQTQ--------------LSQQQLQQQYFQQQYFNQYHQQ--------YHIPVG 239
                 |||..|:.:|              ....|..|.:|:.:|.:..:.|        ||..|.
  Fly   208 -----RRTPLQRISQDTYEGSTTYSSLDIYPNSQALQGFFETKYQHSVNLQCVVTIRHMYHKVVA 267

  Fly   240 Q 240
            |
  Fly   268 Q 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VIINP_733162.2 Ig 31..118 CDD:299845 28/86 (33%)
IG_like 34..118 CDD:214653 26/83 (31%)
Ig 141..>183 CDD:299845 12/41 (29%)
beat-VINP_001263035.1 Ig 66..142 CDD:416386 22/76 (29%)
Ig strand B 67..76 CDD:409353 3/8 (38%)
CDR1 76..83 CDD:409353 0/6 (0%)
Ig strand C 83..91 CDD:409353 2/8 (25%)
FR2 84..91 CDD:409353 2/7 (29%)
CDR2 94..108 CDD:409353 2/13 (15%)
Ig strand C' 94..99 CDD:409353 1/4 (25%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 14/33 (42%)
Ig strand D 117..121 CDD:409353 1/3 (33%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 136..144 CDD:409353 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.