DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VII and MCAM

DIOPT Version :10

Sequence 1:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_006491.2 Gene:MCAM / 4162 HGNCID:6934 Length:646 Species:Homo sapiens


Alignment Length:173 Identity:44/173 - (25%)
Similarity:69/173 - (39%) Gaps:31/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLGLQQTKPINGQSDVLVNLVVPRYVERGSSATFKCTHNVRPEILFKVTWLKVDKGKFFEFINGR 74
            ||...|...:|..|||.|:...|...| |||.|..|......::.|:  ||:.:.|:..|    |
Human   331 LLSEPQELLVNYVSDVRVSPAAPERQE-GSSLTLTCEAESSQDLEFQ--WLREETGQVLE----R 388

  Fly    75 NPPFRNSTIEGAEIDWDNSNEQQVTLKDVQFDLSGQFYCEVSTDTPIFTKASADELMSVFLPQTG 139
            .|..:                    |.|::.:..|.:.|..|  .|.....:..:|::|.:  .|
Human   389 GPVLQ--------------------LHDLKREAGGGYRCVAS--VPSIPGLNRTQLVNVAI--FG 429

  Fly   140 PPTIKFRKRTPFAVGEKLFALCNTTRGRPAPHITWLINGKKVE 182
            ||.:.|::|..:.....:..|.....|.|.|.|:|.:||...|
Human   430 PPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASE 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VIINP_733162.2 IG_like 34..118 CDD:214653 18/83 (22%)
Ig 141..>183 CDD:472250 12/42 (29%)
MCAMNP_006491.2 CD19_double_Ig 35..132 CDD:483967
protodomain 1+3 35..86 CDD:467824
strand A' 35..39 CDD:467824
strand B 41..48 CDD:467824
CDR1 49..58 CDD:467824
strand C 58..65 CDD:467824
strand C' 72..85 CDD:467824
CDR2 86..89 CDD:467824
protodomain 2+4 89..132 CDD:467824
strand D 89..93 CDD:467824
strand E 99..104 CDD:467824
strand F 110..119 CDD:467824
CDR3 119..127 CDD:467824
strand G 127..132 CDD:467824
C2-set_2 139..234 CDD:400489
Ig strand C 171..175 CDD:409353
Ig strand E 192..196 CDD:409353
Ig_3 261..321 CDD:464046
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..299
Ig_3 346..410 CDD:464046 20/90 (22%)
Ig 443..510 CDD:472250 9/30 (30%)
Ig strand B 446..452 CDD:409353 1/5 (20%)
Ig strand C 461..465 CDD:409353 1/3 (33%)
Ig strand F 496..501 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..554
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 620..646
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.