DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VII and CG5597

DIOPT Version :9

Sequence 1:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:205 Identity:47/205 - (22%)
Similarity:74/205 - (36%) Gaps:44/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRFWIIALLLGLQQTK----PINGQSD----VLVNLVVPRYVERGSSATFKCTHNVRPEILF-K 56
            |:...|..|.:||....    |...:|:    ||.|       |........|.:.|.....| .
  Fly     1 MDTLLIAILAIGLLHRDALCYPTRDESEDKIIVLQN-------EEMEPTILDCDYEVEESPKFIT 58

  Fly    57 VTWLKVDKGKFFEFINGRNPP-----FRNSTIEGAEID--WDNSNE-----QQVTLKDVQFDLSG 109
            |.|.:.|| ..:::|.| .||     |||      |||  :::|.|     ..:.|.:.....:|
  Fly    59 VKWYRDDK-SIYQWIFG-TPPYAIPEFRN------EIDSTYESSTEPSKQYSSLALINPTIATTG 115

  Fly   110 QFYCEVSTDTPIFTKASADELMSVFLPQTGPPTIKFRKRTPFAVGEKLFALCNTTRGRPAPHITW 174
            .:.|.|.|....|:.....:::.:     ...|::...:|   :..:....|..|...|.|.||.
  Fly   116 DYKCVVQTSLNTFSSHQRVQVIDL-----RNYTLELSHKT---IHNETQLNCTVTNVYPRPTITI 172

  Fly   175 LINGKKVEDR 184
            :.|...|..|
  Fly   173 ISNDMDVVKR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VIINP_733162.2 Ig 31..118 CDD:299845 24/99 (24%)
IG_like 34..118 CDD:214653 24/96 (25%)
Ig 141..>183 CDD:299845 10/41 (24%)
CG5597NP_611841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.