DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VII and CG13532

DIOPT Version :9

Sequence 1:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster


Alignment Length:155 Identity:34/155 - (21%)
Similarity:64/155 - (41%) Gaps:39/155 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RFWIIALLLGLQQTKPINGQSDVLVNLVVPRYVERGSSATFKCTHNVRPEIL------------F 55
            |..::|:|..|..|..:.     :.||.|||      :.|....|...|.:|            |
  Fly    10 RATLLAVLALLSVTHSVR-----ITNLRVPR------TYTLFRDHEPDPLVLDCEVEIGPREQGF 63

  Fly    56 KVTWLKVDKGKFFEFI---NGRNPPFRNSTIEGAEIDWDNSNEQQVTLKDVQFDLSGQFYCEV-- 115
            .:.|| .:....:::|   .|....|..|.|: .:|.....:...:::|:..::::|::.|.|  
  Fly    64 VLKWL-FNNHSIYQWIPSVKGFAMGFMKSKID-TKIFTMEGSPGVISIKNPDWNMTGEYTCAVQT 126

  Fly   116 --STDTPIFTKASADELMSVFLPQT 138
              |||     |.||  .:.:.:|::
  Fly   127 FESTD-----KRSA--RLQIIVPES 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VIINP_733162.2 Ig 31..118 CDD:299845 21/105 (20%)
IG_like 34..118 CDD:214653 18/102 (18%)
Ig 141..>183 CDD:299845
CG13532NP_611728.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.