DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VII and beat-IIIc

DIOPT Version :9

Sequence 1:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster


Alignment Length:165 Identity:50/165 - (30%)
Similarity:90/165 - (54%) Gaps:3/165 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LVNLVVPRYVERGSSATFKCTHNVRPEILFKVTWLKVDKGKFFEFINGRNPPFRNSTIEGAEIDW 90
            |..:.:|.||.:|::|..:|.:::..|.|:.|.|.| |..:|:.::....||.:...:.|..:|.
  Fly    27 LTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYK-DGNEFYRYVPRDMPPAQTFLLPGVNVDL 90

  Fly    91 DNSNEQQVTLKDVQFDLSGQFYCEVSTDTPIF-TKASADELMSVFLPQTGPPTIKFRKRTPFAVG 154
            .||::..|||::|....:|:|.||||.:.|.| |.....:::..:||..|.|.|. ..|..:.:|
  Fly    91 HNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKIS-GGRPRYQIG 154

  Fly   155 EKLFALCNTTRGRPAPHITWLINGKKVEDRYVRTH 189
            :.:...|...|.:||..::|.:||:.||.:.:|.:
  Fly   155 DYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKLRKY 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VIINP_733162.2 Ig 31..118 CDD:299845 29/86 (34%)
IG_like 34..118 CDD:214653 28/83 (34%)
Ig 141..>183 CDD:299845 12/41 (29%)
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 32/94 (34%)
Ig 42..127 CDD:143165 28/85 (33%)
Ig 140..219 CDD:299845 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.