| Sequence 1: | NP_733162.2 | Gene: | beat-VII / 43213 | FlyBaseID: | FBgn0250908 | Length: | 517 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038943963.1 | Gene: | Cd80 / 25408 | RGDID: | 2314 | Length: | 324 | Species: | Rattus norvegicus |
| Alignment Length: | 223 | Identity: | 45/223 - (20%) |
|---|---|---|---|
| Similarity: | 78/223 - (34%) | Gaps: | 60/223 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 IALLLGL-QQTKPINGQSDVLVNLVVPRYVERGSSATFKCTHNV--RPEILFKVTWLKVDKGKFF 68
Fly 69 EFINGRN---PPFRNSTIEGAEIDWDNSNEQQVTLKDVQFDLSGQFYCEVS------------TD 118
Fly 119 TPIFTKASADELMSVFLPQTGPPTIKFRKRTPFAVGEKLFALCNTTRGRPAPHITWLINGKKV-- 181
Fly 182 ---------EDRYVRTHHVFSFNGKHQH 200 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| beat-VII | NP_733162.2 | Ig | 31..118 | CDD:299845 | 17/103 (17%) |
| IG_like | 34..118 | CDD:214653 | 17/100 (17%) | ||
| Ig | 141..>183 | CDD:299845 | 12/52 (23%) | ||
| Cd80 | XP_038943963.1 | Ig | 40..144 | CDD:416386 | 21/120 (18%) |
| FR1 | 40..55 | CDD:409353 | 4/24 (17%) | ||
| Ig strand A | 41..46 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 50..56 | CDD:409353 | 1/5 (20%) | ||
| CDR1 | 56..65 | CDD:409353 | 0/8 (0%) | ||
| Ig strand C | 66..73 | CDD:409353 | 1/6 (17%) | ||
| FR2 | 66..72 | CDD:409353 | 0/5 (0%) | ||
| CDR2 | 73..92 | CDD:409353 | 6/19 (32%) | ||
| Ig strand C' | 77..82 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 85..88 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 93..126 | CDD:409353 | 8/38 (21%) | ||
| Ig strand D | 95..101 | CDD:409353 | 2/11 (18%) | ||
| Ig strand E | 104..109 | CDD:409353 | 0/4 (0%) | ||
| Ig strand F | 117..127 | CDD:409353 | 3/9 (33%) | ||
| CDR3 | 127..130 | CDD:409353 | 0/2 (0%) | ||
| Ig strand G | 130..144 | CDD:409353 | 1/13 (8%) | ||
| FR4 | 131..144 | CDD:409353 | 1/12 (8%) | ||
| IgC1_CD80 | 147..237 | CDD:409505 | 17/82 (21%) | ||
| Ig strand B | 163..167 | CDD:409505 | 0/3 (0%) | ||
| Ig strand C | 177..181 | CDD:409505 | 0/3 (0%) | ||
| Ig strand E | 207..211 | CDD:409505 | 0/3 (0%) | ||
| Ig strand F | 218..223 | CDD:409505 | 45/223 (20%) | ||
| Ig strand G | 231..234 | CDD:409505 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2D8C9 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1083437at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||