Sequence 1: | NP_733162.2 | Gene: | beat-VII / 43213 | FlyBaseID: | FBgn0250908 | Length: | 517 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016861551.1 | Gene: | CADM2 / 253559 | HGNCID: | 29849 | Length: | 449 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 51/199 - (25%) |
---|---|---|---|
Similarity: | 84/199 - (42%) | Gaps: | 35/199 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 RFW-IIALLLGLQQTKPINGQSDVLVNLVVPRYVERGSSATFKCTHNVR-PEILFKVTWLKVDKG 65
Fly 66 KFFEFINGRNP-----------PFRNSTIEGAEIDWDNSNEQQVTLKDVQFDLSGQFYCEVSTDT 119
Fly 120 PIFTKASADELMSVFLPQTGPPTIKFRKRTPFAVGEKLFALCNTTRGRPAPHITWLINGKKVED- 183
Fly 184 RYVR 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
beat-VII | NP_733162.2 | Ig | 31..118 | CDD:299845 | 21/98 (21%) |
IG_like | 34..118 | CDD:214653 | 21/95 (22%) | ||
Ig | 141..>183 | CDD:299845 | 11/41 (27%) | ||
CADM2 | XP_016861551.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |