DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VII and Cd80

DIOPT Version :9

Sequence 1:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_036015651.1 Gene:Cd80 / 12519 MGIID:101775 Length:314 Species:Mus musculus


Alignment Length:184 Identity:38/184 - (20%)
Similarity:72/184 - (39%) Gaps:47/184 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VLVNLVVPRYVERGSSATFKCTHNVRPEILF--------------KVTWLKVDKGKFFEFINGRN 75
            :|:.:::.|..:..|....:.:.:|:.::|.              ::.|.|.|| .....|.|:.
Mouse    30 ILLFVLLIRLSQVSSDVDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDK-VVLSVIAGKL 93

  Fly    76 ---PPFRNSTIEGAEIDWDNSNEQQVTLKDVQFDLSGQFYC----------EVSTDTPIFTKASA 127
               |.::|.|:      :||:....:.|..|..| .|.:.|          ||.....:.....|
Mouse    94 KVWPEYKNRTL------YDNTTYSLIILGLVLSD-RGTYSCVVQKKERGTYEVKHLALVKLSIKA 151

  Fly   128 DELMSVFLPQTGPPTIKFRKRTPFAVGEKLFALCNTTRGRPAPHITWLINGKKV 181
            | ..:..:.::|.|:...::.|.||.|           |.|.|..:||.||:::
Mouse   152 D-FSTPNITESGNPSADTKRITCFASG-----------GFPKPRFSWLENGREL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VIINP_733162.2 Ig 31..118 CDD:299845 22/113 (19%)
IG_like 34..118 CDD:214653 21/110 (19%)
Ig 141..>183 CDD:299845 12/41 (29%)
Cd80XP_036015651.1 IgV_CD80 47..150 CDD:319335 20/110 (18%)
Ig strand B 58..62 CDD:319335 1/3 (33%)
Ig strand C 75..79 CDD:319335 0/3 (0%)
Ig strand E 110..114 CDD:319335 0/3 (0%)
Ig strand F 124..129 CDD:319335 1/4 (25%)
Ig strand G 142..145 CDD:319335 0/2 (0%)
IgC1_CD80 153..243 CDD:409505 13/52 (25%)
Ig strand B 169..173 CDD:409505 0/3 (0%)
Ig strand C 183..187 CDD:409505 0/3 (0%)
Ig strand E 213..217 CDD:409505
Ig strand F 224..229 CDD:409505
Ig strand G 237..240 CDD:409505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D8C9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.